Sequence 1: | NP_001261910.1 | Gene: | Hip14 / 39747 | FlyBaseID: | FBgn0259824 | Length: | 655 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001071249.1 | Gene: | zdhhc15b / 777734 | ZFINID: | ZDB-GENE-061110-106 | Length: | 332 | Species: | Danio rerio |
Alignment Length: | 243 | Identity: | 59/243 - (24%) |
---|---|---|---|
Similarity: | 96/243 - (39%) | Gaps: | 83/243 - (34%) |
- Green bases have known domain annotations that are detailed below.
Fly 344 EHLMALLPLSVYLATKAWFYVTWLMYIDDAVSFTATVCFLISS---------LLLWVCFL----K 395
Fly 396 SWKGDPGIIRP--TREQRF------KTIIELSER-----------------------GGIGFEPA 429
Fly 430 SFCSGCLVRRPIRSKHCSVCDRCVARFDHHCPWVGNCIGLKNHSYFMGFLWMLLIMCAWMLYGGS 494
Fly 495 KYYVNQCNVRFDDFLGAMRAIGNCDAWVGWV-MGNALLHMSWVILLTI 541 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Hip14 | NP_001261910.1 | ANK | 52..165 | CDD:238125 | |
Ank_2 | 52..142 | CDD:289560 | |||
ANK repeat | 77..108 | CDD:293786 | |||
ANK repeat | 110..142 | CDD:293786 | |||
ANK | 114..233 | CDD:238125 | |||
Ank_2 | 116..209 | CDD:289560 | |||
ANK repeat | 144..175 | CDD:293786 | |||
ANK repeat | 177..209 | CDD:293786 | |||
Ank_5 | 198..251 | CDD:290568 | |||
ANK repeat | 212..244 | CDD:293786 | |||
zf-DHHC | 426..559 | CDD:279823 | 37/117 (32%) | ||
zdhhc15b | NP_001071249.1 | zf-DHHC | 16..292 | CDD:303066 | 59/238 (25%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 305..332 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5273 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |