DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Hip14 and Zdhhc6

DIOPT Version :9

Sequence 1:	NP_001261910.1	Gene:	Hip14 / 39747	FlyBaseID:	FBgn0259824	Length:	655	Species:	Drosophila melanogaster
Sequence 2:	NP_001032741.1	Gene:	Zdhhc6 / 361771	RGDID:	1304657	Length:	413	Species:	Rattus norvegicus

Alignment Length:	203	Identity:	50/203 - (24%)
Similarity:	77/203 - (37%)	Gaps:	72/203 - (35%)

- Green bases have known domain annotations that are detailed below.

  Fly   292 KRLRWWSMVACPFTAFYLAGIVFTVNTLYIIKFFLLGCLYSIFHTIGKALFDEHLMALLPLSVYL 356
            :||..|.    |..|.   |::...:|:.:|...|   .|...||.|.:
  Rat    17 RRLCHWG----PIIAL---GVIAICSTMAMIDSVL---WYWPLHTTGGS---------------- 55

  Fly   357 ATKAWFYVTWLMYIDDAVSFTATVCFLISSLLLWVCFLKSWKGDPGIIRPTREQRFKTIIELSER 421
                   |.::|.|:..|            ::|:..|...:.| ||.: |.
  Rat    56 -------VNFIMLINWTV------------MILYNYFNAMFAG-PGFV-PR-------------- 85

  Fly   422 GGIGFEPAS--------FCSGCLVRRPIRSKHCSVCDRCVARFDHHCPWVGNCIGLKNHSYFMGF 478
               |::|.:        :|..|...:..||.||..|:|||.:.||||||:.||.|.:||:.|..|
  Rat    86 ---GWKPENPQDSMYLQYCKVCQAYKAPRSHHCRKCNRCVMKMDHHCPWINNCCGHQNHASFTLF 147

  Fly   479 LWMLLIMC 486
            |.:..:.|
  Rat   148 LLLAPLGC 155

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Hip14	NP_001261910.1	ANK	52..165	CDD:238125
		Ank_2	52..142	CDD:289560
		ANK repeat	77..108	CDD:293786
		ANK repeat	110..142	CDD:293786
		ANK	114..233	CDD:238125
		Ank_2	116..209	CDD:289560
		ANK repeat	144..175	CDD:293786
		ANK repeat	177..209	CDD:293786
		Ank_5	198..251	CDD:290568
		ANK repeat	212..244	CDD:293786
		zf-DHHC	426..559	CDD:279823	26/69 (38%)
Zdhhc6	NP_001032741.1	DHHC	95..241	CDD:396215	25/61 (41%)
Zdhhc6	NP_001032741.1	SH3_2	317..394	CDD:400139
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG5273
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	1	1.000	-	-
TreeFam	0	0.000	Not matched by this tool.
	3	2.810