DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hip14 and dhhc-8

DIOPT Version :10

Sequence 1:NP_001261910.1 Gene:Hip14 / 39747 FlyBaseID:FBgn0259824 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_001407508.1 Gene:dhhc-8 / 176731 WormBaseID:WBGene00012718 Length:475 Species:Caenorhabditis elegans


Alignment Length:40 Identity:13/40 - (32%)
Similarity:19/40 - (47%) Gaps:10/40 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   362 EHGNVISVTKPSNLSTLKVNINKKK-KDAFQILKPQLEAD 400
            :|..|:.||:         |..||: ||||:.|..:...|
 Worm     3 DHYQVLGVTR---------NATKKEVKDAFRRLAIKYHPD 33

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hip14NP_001261910.1 ANKYR <52..246 CDD:440430
ANK repeat 77..108 CDD:293786
ANK repeat 110..142 CDD:293786
ANK repeat 144..175 CDD:293786
ANK repeat 177..209 CDD:293786
ANK repeat 212..244 CDD:293786
DHHC 426..559 CDD:396215
dhhc-8NP_001407508.1 DHHC 98..232 CDD:396215
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.