DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl1 and ARL1

DIOPT Version :9

Sequence 1:NP_524098.2 Gene:Arl1 / 39745 FlyBaseID:FBgn0000115 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_009723.3 Gene:ARL1 / 852462 SGDID:S000000368 Length:183 Species:Saccharomyces cerevisiae


Alignment Length:182 Identity:109/182 - (59%)
Similarity:138/182 - (75%) Gaps:2/182 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGGVL-SYFRGLLGS-REMRILILGLDGAGKTTILYRLQVGEVVTTIPTIGFNVEQVTYKNLKFQ 63
            ||.:. |.|..|.|| :|:||||||||||||||||||||:||||||.||||||||.::|||||..
Yeast     1 MGNIFSSMFDKLWGSNKELRILILGLDGAGKTTILYRLQIGEVVTTKPTIGFNVETLSYKNLKLN 65

  Fly    64 VWDLGGQTSIRPYWRCYYSNTDAIIYVVDSADRDRIGISKDELLYMLREEELAGAILVVLANKQD 128
            ||||||||||||||||||::|.|:|:||||.|:||:..:..||..||:||||..|.|:|.|||||
Yeast    66 VWDLGGQTSIRPYWRCYYADTAAVIFVVDSTDKDRMSTASKELHLMLQEEELQDAALLVFANKQD 130

  Fly   129 MDGCMTVAEVHHALGLENLKNRTFQIFKTSATKGEGLDQAMDWLSNTLQSRK 180
            ..|.::.:||...|.|..||:|::.|..:||.||||:.:.:|||.:.::..:
Yeast   131 QPGALSASEVSKELNLVELKDRSWSIVASSAIKGEGITEGLDWLIDVIKEEQ 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl1NP_524098.2 Arl1 18..175 CDD:206718 101/156 (65%)
ARL1NP_009723.3 Arl1 20..177 CDD:206718 101/156 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157346208
Domainoid 1 1.000 215 1.000 Domainoid score I483
eggNOG 1 0.900 - - E2759_KOG0072
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H20319
Inparanoid 1 1.050 216 1.000 Inparanoid score I789
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53833
OrthoFinder 1 1.000 - - FOG0004738
OrthoInspector 1 1.000 - - oto99473
orthoMCL 1 0.900 - - OOG6_103249
Panther 1 1.100 - - LDO PTHR11711
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2405
SonicParanoid 1 1.000 - - X3333
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.