DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl1 and AT1G02620

DIOPT Version :10

Sequence 1:NP_524098.2 Gene:Arl1 / 39745 FlyBaseID:FBgn0000115 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_001318907.1 Gene:AT1G02620 / 839269 AraportID:AT1G02620 Length:122 Species:Arabidopsis thaliana


Alignment Length:110 Identity:32/110 - (29%)
Similarity:53/110 - (48%) Gaps:12/110 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 YYSNTDAIIYVVDSADRDRIGISKDELLYMLREEELAGAILVVLANKQDMDGCMTVAEVHHALGL 144
            ::|..||::|:||:.|::|...||.||..:|.:|.||....::|.||.|:....:..|:...|||
plant    13 WFSQVDALVYLVDAYDQERFAESKKELDALLSDESLATVPFLILGNKIDIPYAASEDELRFHLGL 77

  Fly   145 ENLKN------------RTFQIFKTSATKGEGLDQAMDWLSNTLQ 177
            .|...            |..::|..|..:..|..:...|||..::
plant    78 SNFTTGKGKVNLTDSNVRPLEVFMCSIVRKMGYGEGFKWLSQYIK 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl1NP_524098.2 Arl1 18..175 CDD:206718 32/106 (30%)
AT1G02620NP_001318907.1 SAR <12..121 CDD:197556 32/107 (30%)

Return to query results.
Submit another query.