DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl1 and ARFB1C

DIOPT Version :9

Sequence 1:NP_524098.2 Gene:Arl1 / 39745 FlyBaseID:FBgn0000115 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_186962.1 Gene:ARFB1C / 821079 AraportID:AT3G03120 Length:192 Species:Arabidopsis thaliana


Alignment Length:173 Identity:94/173 - (54%)
Similarity:129/173 - (74%) Gaps:0/173 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FRGLLGSREMRILILGLDGAGKTTILYRLQVGEVVTTIPTIGFNVEQVTYKNLKFQVWDLGGQTS 72
            |....|::|||:::||||.||||||||:|.:|||::|:||||||||:|.|||:.|.|||:|||..
plant     9 FDTFFGNQEMRVVMLGLDAAGKTTILYKLHIGEVLSTVPTIGFNVEKVQYKNVIFTVWDVGGQEK 73

  Fly    73 IRPYWRCYYSNTDAIIYVVDSADRDRIGISKDELLYMLREEELAGAILVVLANKQDMDGCMTVAE 137
            :||.||.|::|||.:||||||.||:|||.:|.|...::|:..:..::::|.||||||.|.|:..|
plant    74 LRPLWRHYFNNTDGLIYVVDSLDRERIGKAKQEFQDIIRDPFMLNSVILVFANKQDMRGAMSPRE 138

  Fly   138 VHHALGLENLKNRTFQIFKTSATKGEGLDQAMDWLSNTLQSRK 180
            |...|||.:||||.:.|..|.|.:|:||.:.:||||.||:..|
plant   139 VCEGLGLLDLKNRKWHIQGTCALQGDGLYEGLDWLSATLKEVK 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl1NP_524098.2 Arl1 18..175 CDD:206718 87/156 (56%)
ARFB1CNP_186962.1 Arf1_5_like 18..176 CDD:206717 88/157 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53833
OrthoDB 1 1.010 - - D1271528at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.020

Return to query results.
Submit another query.