DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl1 and ARF3

DIOPT Version :9

Sequence 1:NP_524098.2 Gene:Arl1 / 39745 FlyBaseID:FBgn0000115 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_850057.1 Gene:ARF3 / 817014 AraportID:AT2G24765 Length:182 Species:Arabidopsis thaliana


Alignment Length:178 Identity:113/178 - (63%)
Similarity:141/178 - (79%) Gaps:2/178 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 GVL--SYFRGLLGSREMRILILGLDGAGKTTILYRLQVGEVVTTIPTIGFNVEQVTYKNLKFQVW 65
            |:|  ..|..:.|::|.|||:||||.|||||||||||:||||:||||||||||.|.|.|:|||||
plant     2 GILFTRMFSSVFGNKEARILVLGLDNAGKTTILYRLQMGEVVSTIPTIGFNVETVQYNNIKFQVW 66

  Fly    66 DLGGQTSIRPYWRCYYSNTDAIIYVVDSADRDRIGISKDELLYMLREEELAGAILVVLANKQDMD 130
            |||||||||||||||:.||.|:||||||:|.||||::|:|...:|.|:||.||::::.|||||:.
plant    67 DLGGQTSIRPYWRCYFPNTQAVIYVVDSSDTDRIGVAKEEFHAILEEDELKGAVVLIFANKQDLP 131

  Fly   131 GCMTVAEVHHALGLENLKNRTFQIFKTSATKGEGLDQAMDWLSNTLQS 178
            |.:..|.|..||.|..:|:|.:.||||.|.|||||.:.:|||||||:|
plant   132 GALDDAAVTEALELHKIKSRQWAIFKTCAVKGEGLFEGLDWLSNTLKS 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl1NP_524098.2 Arl1 18..175 CDD:206718 104/156 (67%)
ARF3NP_850057.1 Arl1 19..176 CDD:206718 104/156 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 232 1.000 Domainoid score I648
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H20319
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53833
OrthoDB 1 1.010 - - D1271528at2759
OrthoFinder 1 1.000 - - FOG0004738
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103249
Panther 1 1.100 - - LDO PTHR11711
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3333
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.980

Return to query results.
Submit another query.