DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl1 and ARFB1A

DIOPT Version :9

Sequence 1:NP_524098.2 Gene:Arl1 / 39745 FlyBaseID:FBgn0000115 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_179133.1 Gene:ARFB1A / 816020 AraportID:AT2G15310 Length:205 Species:Arabidopsis thaliana


Alignment Length:168 Identity:85/168 - (50%)
Similarity:121/168 - (72%) Gaps:0/168 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LGSREMRILILGLDGAGKTTILYRLQVGEVVTTIPTIGFNVEQVTYKNLKFQVWDLGGQTSIRPY 76
            |...::|||::||||:|||||||:|::||||||:||||||:|.|.||.:.|.|||:|||..||..
plant    13 LPKSKVRILMVGLDGSGKTTILYKLKLGEVVTTVPTIGFNLETVEYKGINFTVWDIGGQEKIRKL 77

  Fly    77 WRCYYSNTDAIIYVVDSADRDRIGISKDELLYMLREEELAGAILVVLANKQDMDGCMTVAEVHHA 141
            ||.|:.|...:|:||||:|.:|:..:::||..:|.:.||.||.::|.|||||....:.||||.:.
plant    78 WRHYFQNAQGLIFVVDSSDSERLSEARNELHRILTDNELEGACVLVFANKQDSRNALPVAEVANK 142

  Fly   142 LGLENLKNRTFQIFKTSATKGEGLDQAMDWLSNTLQSR 179
            |||.:|..|.:.|..|||..|:||.:.::|||.|:.::
plant   143 LGLHSLSKRCWLIQGTSAISGQGLYEGLEWLSTTIPNK 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl1NP_524098.2 Arl1 18..175 CDD:206718 83/156 (53%)
ARFB1ANP_179133.1 P-loop_NTPase 1..180 CDD:304359 85/166 (51%)
Ras 19..179 CDD:278499 84/159 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53833
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.