DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl1 and Trim23

DIOPT Version :9

Sequence 1:NP_524098.2 Gene:Arl1 / 39745 FlyBaseID:FBgn0000115 Length:180 Species:Drosophila melanogaster
Sequence 2:XP_008758905.1 Gene:Trim23 / 81002 RGDID:621587 Length:601 Species:Rattus norvegicus


Alignment Length:162 Identity:82/162 - (50%)
Similarity:112/162 - (69%) Gaps:1/162 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 EMRILILGLDGAGKTTILYRLQVGEVVTTIPTIGFNVEQVTYKNLKFQVWDLGGQTSIRPYWRCY 80
            |:|::.||||||||||||::|:..|.:..|||||||||.|.||||||.:||:||:..:||.|:.|
  Rat   431 EIRVVTLGLDGAGKTTILFKLKQDEFMQPIPTIGFNVETVEYKNLKFTIWDVGGKHKLRPLWKHY 495

  Fly    81 YSNTDAIIYVVDSADRDRIGISKDELLYMLREEELAGAILVVLANKQDMDGCMTVAEVHHALGLE 145
            |.||.|:::||||:.||||..:..||..:|.|:||..|:|::.|||||:.|.::|.|:...|.|.
  Rat   496 YLNTQAVVFVVDSSHRDRISEAHSELAKLLTEKELRDALLLIFANKQDVAGALSVEEITELLSLH 560

  Fly   146 NL-KNRTFQIFKTSATKGEGLDQAMDWLSNTL 176
            .| ..|::.|....|..|.||.:.:||||..|
  Rat   561 KLCCGRSWYIQGCDARSGMGLYEGLDWLSRQL 592

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl1NP_524098.2 Arl1 18..175 CDD:206718 80/157 (51%)
Trim23XP_008758905.1 zf-RING_UBOX 58..100 CDD:290181
BBOX 152..195 CDD:237988
BBOX 200..246 CDD:197662
BBC 253..397 CDD:128778
ARD1 433..601 CDD:206723 81/160 (51%)
Ras 433..592 CDD:278499 80/158 (51%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.