DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl1 and Sar1b

DIOPT Version :10

Sequence 1:NP_524098.2 Gene:Arl1 / 39745 FlyBaseID:FBgn0000115 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_079811.1 Gene:Sar1b / 66397 MGIID:1913647 Length:198 Species:Mus musculus


Alignment Length:112 Identity:21/112 - (18%)
Similarity:35/112 - (31%) Gaps:58/112 - (51%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 SLLRQCIGKYGEGKWHQVPLRAGLNRCRKSCRLRWLNYLKPSIKRGKFSSDEVDLLLRLHKLLGN 83
            |||||....||              :|:                  :|..|:|.|.::.::::..
Mouse    63 SLLRQIQQSYG--------------KCK------------------EFGDDKVQLAMQTYEMVDK 95

  Fly    84 RYNLL--------------------YSTYLTSNKSNTSNSYVYVGGP 110
            ....|                    |.:  ||:|.|.|:    :.||
Mouse    96 HIRRLDTDLARFEADLKEKQIESTDYDS--TSSKGNKSD----IRGP 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl1NP_524098.2 Arl1 18..175 CDD:206718 21/112 (19%)
Sar1bNP_079811.1 Sar1 3..197 CDD:206645 21/112 (19%)
STAR, SAR1-N-terminal activation recruitment. Required for the activation by PREB and subsequent recruitment to ER membrane. /evidence=ECO:0000250|UniProtKB:Q9QVY3 3..5
Mediates recruitment to ER membranes. /evidence=ECO:0000250|UniProtKB:Q9QVY3 15..19
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.