DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl1 and Arl2

DIOPT Version :9

Sequence 1:NP_524098.2 Gene:Arl1 / 39745 FlyBaseID:FBgn0000115 Length:180 Species:Drosophila melanogaster
Sequence 2:XP_006230961.1 Gene:Arl2 / 65142 RGDID:69326 Length:210 Species:Rattus norvegicus


Alignment Length:191 Identity:75/191 - (39%)
Similarity:112/191 - (58%) Gaps:26/191 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 REMRILILGLDGAGKTTILYRLQVGEVVTTIPTIGFNVEQVTYKNLKFQVWDLGGQTSIRPYWRC 79
            ||:|:|:||||.|||||||.:....:|.|..||:|||::.:.::..|..:||:|||.|:|.|||.
  Rat    15 RELRLLMLGLDNAGKTTILKKFNGEDVDTISPTLGFNIKTLEHRGFKLNIWDVGGQKSLRSYWRN 79

  Fly    80 YYSNTDAIIYVVDSADRDRIGISKDELLYMLRE--------------------------EELAGA 118
            |:.:||.:|:|||||||.|:...:.||..:|.|                          |.||||
  Rat    80 YFESTDGLIWVVDSADRQRMQDCQRELQSLLVEEVCPVLTGSQATACHKCHGLLGHSGRERLAGA 144

  Fly   119 ILVVLANKQDMDGCMTVAEVHHALGLENLKNRTFQIFKTSATKGEGLDQAMDWLSNTLQSR 179
            .|::.|||||:.|.::...:..||.|:::::..::|...||..||.|...:|||.:.:.||
  Rat   145 TLLIFANKQDLPGALSCNAIQEALELDSIRSHHWRIQGCSAVTGEDLLPGIDWLLDDISSR 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl1NP_524098.2 Arl1 18..175 CDD:206718 71/182 (39%)
Arl2XP_006230961.1 Arl2 3..201 CDD:206720 73/185 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271528at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.