DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl1 and arl6

DIOPT Version :9

Sequence 1:NP_524098.2 Gene:Arl1 / 39745 FlyBaseID:FBgn0000115 Length:180 Species:Drosophila melanogaster
Sequence 2:XP_021329928.1 Gene:arl6 / 494134 ZFINID:ZDB-GENE-041219-2 Length:194 Species:Danio rerio


Alignment Length:180 Identity:65/180 - (36%)
Similarity:105/180 - (58%) Gaps:6/180 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 GVLSYFRGLLG--SREMRILILGLDGAGKTTILYRLQV--GEVVTTIPTIGFNVEQVTYKNLKFQ 63
            |:.....|.||  .:|:.:|.||||.:|||||:.:|:.  .:....:|||||::|:....:|.|.
Zfish     2 GLFDKLAGWLGLKKKEVNVLCLGLDNSGKTTIINQLKPSNAQAQDIVPTIGFSIEKFKTSSLSFT 66

  Fly    64 VWDLGGQTSIRPYWRCYYSNTDAIIYVVDSADRDRIGISKDELLYMLREEELAGAILVVL--ANK 126
            |:|:.||...|..|..||....|||:|:||.|:.|:.::|:||..:|...::....:.:|  |||
Zfish    67 VFDMSGQGRYRNLWEHYYKEGQAIIFVIDSGDKLRMVVAKEELDTLLNHPDIKHRRIPLLFFANK 131

  Fly   127 QDMDGCMTVAEVHHALGLENLKNRTFQIFKTSATKGEGLDQAMDWLSNTL 176
            .|:...::..:|...|.|||:|::.:.|..:.|.|||||.:.:|||...:
Zfish   132 MDLRDALSAVKVSQLLCLENIKDKPWHICASDAVKGEGLLEGVDWLQEQI 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl1NP_524098.2 Arl1 18..175 CDD:206718 60/160 (38%)
arl6XP_021329928.1 Arl6 19..180 CDD:206722 60/160 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53833
OrthoDB 1 1.010 - - D1271528at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.