DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl1 and dnd

DIOPT Version :9

Sequence 1:NP_524098.2 Gene:Arl1 / 39745 FlyBaseID:FBgn0000115 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_650995.1 Gene:dnd / 42580 FlyBaseID:FBgn0038916 Length:179 Species:Drosophila melanogaster


Alignment Length:177 Identity:78/177 - (44%)
Similarity:109/177 - (61%) Gaps:2/177 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 GVLSYFRGLLGS--REMRILILGLDGAGKTTILYRLQVGEVVTTIPTIGFNVEQVTYKNLKFQVW 65
            |:||..|.|..:  :|.|||:||||.|||||||.:|...::.|..||.|||::.|.....|..||
  Fly     2 GLLSLLRKLRPNPEKEARILLLGLDNAGKTTILKQLASEDITTVTPTAGFNIKSVAADGFKLNVW 66

  Fly    66 DLGGQTSIRPYWRCYYSNTDAIIYVVDSADRDRIGISKDELLYMLREEELAGAILVVLANKQDMD 130
            |:|||..|||||:.|::|||.:|||:|..||.|:..:..||..||.:..|....:::.||||||.
  Fly    67 DIGGQWKIRPYWKNYFANTDVLIYVIDCTDRTRLPEAGSELFEMLMDNRLKQVPVLIFANKQDMP 131

  Fly   131 GCMTVAEVHHALGLENLKNRTFQIFKTSATKGEGLDQAMDWLSNTLQ 177
            ..|:.|||...:.|..|:.||::|...:|..|.||.:.|||:...::
  Fly   132 DAMSAAEVAEKMSLVQLQGRTWEIKACTAVDGTGLKEGMDWVCKNMK 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl1NP_524098.2 Arl1 18..175 CDD:206718 72/156 (46%)
dndNP_650995.1 Arl3 3..176 CDD:206721 77/172 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455890
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271528at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.