DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl1 and CG17819

DIOPT Version :9

Sequence 1:NP_524098.2 Gene:Arl1 / 39745 FlyBaseID:FBgn0000115 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_650994.1 Gene:CG17819 / 42579 FlyBaseID:FBgn0038915 Length:186 Species:Drosophila melanogaster


Alignment Length:191 Identity:58/191 - (30%)
Similarity:102/191 - (53%) Gaps:23/191 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 GVLSYFRGLL--GSREMRILILGLDGAGKTTILYRLQVGEVVTTIPTIGFNVE------QV---- 55
            |.:|:.:.:|  ||::..:||||||.|||:|:..||  .|:        ||.|      ||    
  Fly     5 GPVSFIKKILPAGSQKSCLLILGLDNAGKSTLTDRL--AEI--------FNGESKESNNQVSEWS 59

  Fly    56 -TYKNLKFQVWDLGGQTSIRPYWRCYYSNTDAIIYVVDSADRDRIGISKDELLYMLREEELAGAI 119
             |..|.:.|:||:.|:...|..|..||...:.:|:|:||.|..|:..::..|..:|..:||..|.
  Fly    60 FTINNFRVQLWDINGELKNRQIWPKYYKKVNVLIFVLDSTDALRLSEARCVLCDVLMHQELDNAP 124

  Fly   120 LVVLANKQDMDGCMTVAEVHHALGLENLKNRTFQIFKTSATKGEGLDQAMDWLSNTLQSRK 180
            |::::||:|..|.::::.|...:||..|..|.:...:.|...|.|:.:.::|::..:.:.:
  Fly   125 LLIVSNKKDASGSLSMSTVIDLMGLYRLTGRDWTFEECSMRTGSGVQEIVNWINEKINNNR 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl1NP_524098.2 Arl1 18..175 CDD:206718 53/167 (32%)
CG17819NP_650994.1 Arf_Arl 22..180 CDD:206644 53/167 (32%)
Ras 23..183 CDD:278499 53/169 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455839
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11711
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.