DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl1 and Arl2

DIOPT Version :9

Sequence 1:NP_524098.2 Gene:Arl1 / 39745 FlyBaseID:FBgn0000115 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_476886.1 Gene:Arl2 / 40993 FlyBaseID:FBgn0004908 Length:184 Species:Drosophila melanogaster


Alignment Length:166 Identity:79/166 - (47%)
Similarity:108/166 - (65%) Gaps:2/166 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 REMRILILGLDGAGKTTILYRLQVGEVVTTI-PTIGFNVEQVTYKNLKFQVWDLGGQTSIRPYWR 78
            ||||||:||||.|||||||.|.. ||.:.|| ||:|||::.:.:......:||:|||.|:|.|||
  Fly    15 REMRILLLGLDNAGKTTILKRFN-GEPIDTISPTLGFNIKTLEHNGYTLNMWDVGGQKSLRSYWR 78

  Fly    79 CYYSNTDAIIYVVDSADRDRIGISKDELLYMLREEELAGAILVVLANKQDMDGCMTVAEVHHALG 143
            .|:.:||.:::|||||||.|:.....||..:|:||.||||.|:||.||||:.|.::..|:...|.
  Fly    79 NYFESTDGLVWVVDSADRMRLESCGQELQVLLQEERLAGATLLVLCNKQDLPGALSSNEIKEILH 143

  Fly   144 LENLKNRTFQIFKTSATKGEGLDQAMDWLSNTLQSR 179
            ||::....:.:...||..||.|..:||||...:..|
  Fly   144 LEDITTHHWLVAGVSAVTGEKLLSSMDWLIADIAKR 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl1NP_524098.2 Arl1 18..175 CDD:206718 75/157 (48%)
Arl2NP_476886.1 Arl2 3..175 CDD:206720 78/160 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455894
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271528at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.