DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl1 and arl3l1

DIOPT Version :9

Sequence 1:NP_524098.2 Gene:Arl1 / 39745 FlyBaseID:FBgn0000115 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_956987.1 Gene:arl3l1 / 393666 ZFINID:ZDB-GENE-040426-1649 Length:187 Species:Danio rerio


Alignment Length:180 Identity:78/180 - (43%)
Similarity:113/180 - (62%) Gaps:2/180 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 GVLSYFRGLLGS--REMRILILGLDGAGKTTILYRLQVGEVVTTIPTIGFNVEQVTYKNLKFQVW 65
            |:.|....|.|:  :|:||::||||.|||||:|.:|...:|.|..||.|||::.||...:|..||
Zfish     7 GLFSVIEKLKGTTEQELRIVLLGLDNAGKTTLLKQLASEDVNTITPTQGFNIKSVTCDGMKLNVW 71

  Fly    66 DLGGQTSIRPYWRCYYSNTDAIIYVVDSADRDRIGISKDELLYMLREEELAGAILVVLANKQDMD 130
            |:|||..|||:|:.|..|||.:|||:||||:.|...:..||..::.||.|.|..|::.|||||:.
Zfish    72 DIGGQRKIRPFWKKYLENTDLLIYVIDSADKKRFEETGLELSELIDEENLKGVPLLIFANKQDLA 136

  Fly   131 GCMTVAEVHHALGLENLKNRTFQIFKTSATKGEGLDQAMDWLSNTLQSRK 180
            .....:|:...|.|...::|.:||...||..|||:...|:|:||.:.::|
Zfish   137 TASPASEIAEGLNLHTYRDREWQIQACSAVSGEGVQDGMNWISNNIVNKK 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl1NP_524098.2 Arl1 18..175 CDD:206718 71/156 (46%)
arl3l1NP_956987.1 Arl3 8..181 CDD:206721 75/172 (44%)
SAR 17..182 CDD:197556 74/164 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271528at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.