DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl1 and ARL10

DIOPT Version :9

Sequence 1:NP_524098.2 Gene:Arl1 / 39745 FlyBaseID:FBgn0000115 Length:180 Species:Drosophila melanogaster
Sequence 2:XP_011532831.1 Gene:ARL10 / 285598 HGNCID:22042 Length:281 Species:Homo sapiens


Alignment Length:208 Identity:61/208 - (29%)
Similarity:96/208 - (46%) Gaps:54/208 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LGSREMRILILGLDGAGKTTILYRLQVGE--VVTTIPTIGFNVEQVTYKNLKFQVWDLGGQTSIR 74
            |..||  :|:||||||||:|.| |:..|:  :...|||.|||..::..|:.:..:.::||..::|
Human    75 LEQRE--VLVLGLDGAGKSTFL-RVLSGKPPLEGHIPTWGFNSVRLPTKDFEVDLLEIGGSQNLR 136

  Fly    75 PYWRCYYSNTDAIIYVVDSADRDRIGISKDELLYML-REEELAGAILVVLANKQD---------- 128
            .||:.:.|..|.:::|||||||.|:..::.||..:| ::.:|.   :||:||||.          
Human   137 FYWKEFVSEVDVLVFVVDSADRLRLPWARQELHKLLDKDPDLP---VVVVANKQTGSHSAAQAGV 198

  Fly   129 --------------------------MDGCMTVAEVHHA---------LGLENLKNRTFQIFKTS 158
                                      ..|..|.|..|||         :|..::......:.:..
Human   199 QRRDHSTRRPTYTSRAQAMLLPQPSRAAGTTTTATCHHAWLIFVCFVEMGFHHVAQAPQHLKEHG 263

  Fly   159 ATKGEGLDQAMDW 171
            |...|..||.:||
Human   264 AQSWEAWDQVLDW 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl1NP_524098.2 Arl1 18..175 CDD:206718 58/202 (29%)
ARL10XP_011532831.1 P-loop_NTPase 79..>187 CDD:304359 44/113 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0072
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.