DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl1 and alp41

DIOPT Version :9

Sequence 1:NP_524098.2 Gene:Arl1 / 39745 FlyBaseID:FBgn0000115 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_001342799.1 Gene:alp41 / 2541769 PomBaseID:SPAC22F3.05c Length:186 Species:Schizosaccharomyces pombe


Alignment Length:179 Identity:71/179 - (39%)
Similarity:110/179 - (61%) Gaps:1/179 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 GVLSYFR-GLLGSREMRILILGLDGAGKTTILYRLQVGEVVTTIPTIGFNVEQVTYKNLKFQVWD 66
            |:|:..| ..|..||:|:|:||||.|||||||..|...:|....||.||.:..:..:.|:|.:||
pombe     2 GLLTILRQQKLKEREVRVLLLGLDNAGKTTILKCLLNEDVNEVSPTFGFQIRTLEVEGLRFTIWD 66

  Fly    67 LGGQTSIRPYWRCYYSNTDAIIYVVDSADRDRIGISKDELLYMLREEELAGAILVVLANKQDMDG 131
            :|||.::|.:|:.|:.:|:|||:||||.|..|:...::.|..:|.||:|....::|||||.|:.|
pombe    67 IGGQKTLRNFWKNYFESTEAIIWVVDSLDDLRLEECRNTLQELLVEEKLLFTSILVLANKSDVSG 131

  Fly   132 CMTVAEVHHALGLENLKNRTFQIFKTSATKGEGLDQAMDWLSNTLQSRK 180
            .::..|:...|.:...|:..::||..||..|..:..|:.||:|.|:..|
pombe   132 ALSSEEISKILNISKYKSSHWRIFSVSALTGLNIKDAISWLANDLKEIK 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl1NP_524098.2 Arl1 18..175 CDD:206718 62/156 (40%)
alp41NP_001342799.1 Arl2 3..175 CDD:206720 67/171 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.