DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl1 and arf6

DIOPT Version :9

Sequence 1:NP_524098.2 Gene:Arl1 / 39745 FlyBaseID:FBgn0000115 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_596822.1 Gene:arf6 / 2539937 PomBaseID:SPBC1539.08 Length:184 Species:Schizosaccharomyces pombe


Alignment Length:180 Identity:89/180 - (49%)
Similarity:125/180 - (69%) Gaps:9/180 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGGVLSYFRG-------LLGSREMRILILGLDGAGKTTILYRLQVGEVVTTIPTIGFNVEQVTYK 58
            ||.  |.|:|       |..::|||||:||||.||||||||:|::.:.|.||||:|||||.||||
pombe     1 MGN--SLFKGFSKPFSRLFSNKEMRILMLGLDAAGKTTILYKLKLNQSVVTIPTVGFNVETVTYK 63

  Fly    59 NLKFQVWDLGGQTSIRPYWRCYYSNTDAIIYVVDSADRDRIGISKDELLYMLREEELAGAILVVL 123
            |:||.|||:|||..|||.||.|::.|..:|:||||||.:||..::.||..::.:.|:...:|:||
pombe    64 NIKFNVWDVGGQDKIRPLWRHYFTGTKGLIFVVDSADSNRISEARQELHRIISDREMRDCLLLVL 128

  Fly   124 ANKQDMDGCMTVAEVHHALGLENLKNRTFQIFKTSATKGEGLDQAMDWLS 173
            |||||:.|.::.|::...|.|:.||:|.:.:..|.|..|:||.:.:.|||
pombe   129 ANKQDLPGALSPAQITDVLQLDKLKDRLWNVQPTCALTGDGLLEGLAWLS 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl1NP_524098.2 Arl1 18..175 CDD:206718 81/156 (52%)
arf6NP_596822.1 Arf6 13..180 CDD:206716 84/166 (51%)
SAR 19..179 CDD:197556 83/160 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53833
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.