DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl1 and Sar1a

DIOPT Version :10

Sequence 1:NP_524098.2 Gene:Arl1 / 39745 FlyBaseID:FBgn0000115 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_033146.1 Gene:Sar1a / 20224 MGIID:98230 Length:198 Species:Mus musculus


Alignment Length:178 Identity:52/178 - (29%)
Similarity:89/178 - (50%) Gaps:13/178 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FRGLLGSREMRILILGLDGAGKTTILYRLQVGEVVTTIPTIGFNVEQVTYKNLKFQVWDLGGQTS 72
            |.||. .:..:::.||||.|||||:|:.|:...:...:||:....|::|...:.|..:||||...
Mouse    18 FLGLY-KKSGKLVFLGLDNAGKTTLLHMLKDDRLGQHVPTLHPTSEELTIAGMTFTTFDLGGHEQ 81

  Fly    73 IRPYWRCYYSNTDAIIYVVDSADRDRIGISKDELLYMLREEELAGAILVVLANKQDMDGCMTVAE 137
            .|..|:.|....:.|:::||.||..|:..||.||..::.:|.::...:::|.||.|....::..:
Mouse    82 ARRVWKNYLPAINGIVFLVDCADHSRLMESKVELNALMTDETISNVPILILGNKIDRTDAISEEK 146

  Fly   138 VHHALG------------LENLKNRTFQIFKTSATKGEGLDQAMDWLS 173
            :....|            |:.|..|..::|..|..|.:|..:...|||
Mouse   147 LREIFGLYGQTTGKGNVTLKELNARPMEVFMCSVLKRQGYGEGFRWLS 194

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
Arl1NP_524098.2 Arl1 18..175 CDD:206718 49/168 (29%)
Sar1aNP_033146.1 Sar1 3..197 CDD:206645 52/178 (29%)
STAR, SAR1-N-terminal activation recruitment. Required for the activation by PREB and subsequent recruitment to ER membrane. /evidence=ECO:0000250|UniProtKB:Q9QVY3 3..5