DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl1 and Y54E10BR.2

DIOPT Version :9

Sequence 1:NP_524098.2 Gene:Arl1 / 39745 FlyBaseID:FBgn0000115 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_491094.1 Gene:Y54E10BR.2 / 171878 WormBaseID:WBGene00021841 Length:191 Species:Caenorhabditis elegans


Alignment Length:175 Identity:52/175 - (29%)
Similarity:86/175 - (49%) Gaps:13/175 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 REMRILILGLDGAGKTTIL----------YRLQVGEVVTTIPTIGFNVEQVTYKNLKFQVWDLGG 69
            ::..::|:|||.|||||.|          |.:.....:|.  |:|.|...|...|.....|||||
 Worm    16 KDYYVVIVGLDNAGKTTFLEQTKSHFVKDYGVLNPSKITA--TVGLNTGNVELNNTCLHFWDLGG 78

  Fly    70 QTSIRPYWRCYYSNTDAIIYVVDSADRDRIGISKDELLYMLREEELAGAILVVLANKQDMDGCMT 134
            |.|:|..|..||.:.:|:|:|||:...|...|...:...::..|.:....::|..||.:|:|...
 Worm    79 QESLRELWATYYDDANAMIFVVDATRSDLFPIVASQFKEVMANEIVQNIPVLVAVNKSEMEGAAA 143

  Fly   135 VAEVHHALGLENLKNRTFQIFKTSATKGEGLDQAMDWLSNTLQSR 179
            .|||...|..:|.:: ...:...||.:|..:::.:.|:..:|.|:
 Worm   144 AAEVRMLLEDDNHRS-DLAVLPVSALEGTNIERCVHWIVRSLASQ 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl1NP_524098.2 Arl1 18..175 CDD:206718 50/166 (30%)
Y54E10BR.2NP_491094.1 small_GTP 17..174 CDD:272973 49/159 (31%)
Arfrp1 19..183 CDD:206725 50/166 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271528at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.