DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl1 and Arf4

DIOPT Version :10

Sequence 1:NP_524098.2 Gene:Arl1 / 39745 FlyBaseID:FBgn0000115 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_031505.1 Gene:Arf4 / 11843 MGIID:99433 Length:180 Species:Mus musculus


Alignment Length:176 Identity:97/176 - (55%)
Similarity:128/176 - (72%) Gaps:0/176 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VLSYFRGLLGSREMRILILGLDGAGKTTILYRLQVGEVVTTIPTIGFNVEQVTYKNLKFQVWDLG 68
            :.|.|..|.|.::||||::|||.||||||||:|::||:||||||||||||.|.|||:.|.|||:|
Mouse     5 ISSLFSRLFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTVWDVG 69

  Fly    69 GQTSIRPYWRCYYSNTDAIIYVVDSADRDRIGISKDELLYMLREEELAGAILVVLANKQDMDGCM 133
            ||..|||.||.|:.||..:|:||||.||:||......|..||.|:||..|:|::.|||||:...|
Mouse    70 GQDKIRPLWRHYFQNTQGLIFVVDSNDRERIQEGAAVLQKMLLEDELQDAVLLLFANKQDLPNAM 134

  Fly   134 TVAEVHHALGLENLKNRTFQIFKTSATKGEGLDQAMDWLSNTLQSR 179
            .::|:...|||::|:|||:.:..|.||:|.||.:.:|||||.|..|
Mouse   135 AISEMTDKLGLQSLRNRTWYVQATCATQGTGLYEGLDWLSNELSKR 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl1NP_524098.2 Arl1 18..175 CDD:206718 89/156 (57%)
Arf4NP_031505.1 P-loop containing Nucleoside Triphosphate Hydrolases 1..180 CDD:476819 96/174 (55%)

Return to query results.
Submit another query.