DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl1 and Arl1

DIOPT Version :9

Sequence 1:NP_524098.2 Gene:Arl1 / 39745 FlyBaseID:FBgn0000115 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_080135.2 Gene:Arl1 / 104303 MGIID:99436 Length:181 Species:Mus musculus


Alignment Length:181 Identity:143/181 - (79%)
Similarity:156/181 - (86%) Gaps:1/181 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGGVL-SYFRGLLGSREMRILILGLDGAGKTTILYRLQVGEVVTTIPTIGFNVEQVTYKNLKFQV 64
            |||.. |.|..|.|:|||||||||||||||||||||||||||||||||||||||.||||||||||
Mouse     1 MGGFFSSIFSSLFGTREMRILILGLDGAGKTTILYRLQVGEVVTTIPTIGFNVETVTYKNLKFQV 65

  Fly    65 WDLGGQTSIRPYWRCYYSNTDAIIYVVDSADRDRIGISKDELLYMLREEELAGAILVVLANKQDM 129
            ||||||||||||||||||||||:||||||.|||||||||.||:.||.||||..|||||.||||||
Mouse    66 WDLGGQTSIRPYWRCYYSNTDAVIYVVDSCDRDRIGISKSELVAMLEEEELRKAILVVFANKQDM 130

  Fly   130 DGCMTVAEVHHALGLENLKNRTFQIFKTSATKGEGLDQAMDWLSNTLQSRK 180
            :..||.:|:.:||||..||:|.:||||||||||.|||:||:||..||:||:
Mouse   131 EQAMTPSEMANALGLPALKDRKWQIFKTSATKGTGLDEAMEWLVETLKSRQ 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl1NP_524098.2 Arl1 18..175 CDD:206718 129/156 (83%)
Arl1NP_080135.2 Arl1 19..176 CDD:206718 128/156 (82%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167849418
Domainoid 1 1.000 272 1.000 Domainoid score I1800
eggNOG 1 0.900 - - E2759_KOG0072
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H20319
Inparanoid 1 1.050 280 1.000 Inparanoid score I2890
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53833
OrthoDB 1 1.010 - - D1271528at2759
OrthoFinder 1 1.000 - - FOG0004738
OrthoInspector 1 1.000 - - oto93177
orthoMCL 1 0.900 - - OOG6_103249
Panther 1 1.100 - - LDO PTHR11711
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2405
SonicParanoid 1 1.000 - - X3333
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1615.800

Return to query results.
Submit another query.