DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl1 and arl3

DIOPT Version :9

Sequence 1:NP_524098.2 Gene:Arl1 / 39745 FlyBaseID:FBgn0000115 Length:180 Species:Drosophila melanogaster
Sequence 2:XP_002938771.2 Gene:arl3 / 100492073 XenbaseID:XB-GENE-956688 Length:182 Species:Xenopus tropicalis


Alignment Length:180 Identity:78/180 - (43%)
Similarity:114/180 - (63%) Gaps:2/180 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 GVLSYFRGLLGS--REMRILILGLDGAGKTTILYRLQVGEVVTTIPTIGFNVEQVTYKNLKFQVW 65
            |:||..|.|..:  :|:|||:||||.|||||:|.:|...::....||.|||::.|..:..|..||
 Frog     2 GLLSILRKLKSAPDQEVRILLLGLDNAGKTTLLKQLASEDISHITPTQGFNIKSVQSQGFKLNVW 66

  Fly    66 DLGGQTSIRPYWRCYYSNTDAIIYVVDSADRDRIGISKDELLYMLREEELAGAILVVLANKQDMD 130
            |:|||..||||||.|:.|||.:|||:|||||.|...:..||..:|.||:|:|..:::.|||||:.
 Frog    67 DIGGQRKIRPYWRNYFENTDVLIYVIDSADRKRFEETGQELAELLDEEKLSGVPVLIFANKQDLL 131

  Fly   131 GCMTVAEVHHALGLENLKNRTFQIFKTSATKGEGLDQAMDWLSNTLQSRK 180
            .....:|:...|.|..:::|.:||...||..|||:...|:|:...:.::|
 Frog   132 TAAPASEIAEGLNLHTIRDRVWQIQSCSALTGEGVQDGMNWVCKNVNAKK 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl1NP_524098.2 Arl1 18..175 CDD:206718 71/156 (46%)
arl3XP_002938771.2 Arl3 3..176 CDD:206721 76/172 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271528at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.