DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl1 and arl11

DIOPT Version :9

Sequence 1:NP_524098.2 Gene:Arl1 / 39745 FlyBaseID:FBgn0000115 Length:180 Species:Drosophila melanogaster
Sequence 2:XP_002935781.1 Gene:arl11 / 100490310 XenbaseID:XB-GENE-1012125 Length:180 Species:Xenopus tropicalis


Alignment Length:167 Identity:73/167 - (43%)
Similarity:114/167 - (68%) Gaps:1/167 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LGSREMRILILGLDGAGKTTILYRLQVGEVVTTIPTIGFNVEQVTY-KNLKFQVWDLGGQTSIRP 75
            |..::.|::::|||.:||:||||:|::.::|.|.||:|||||.:.. ||:...|||:|||..:||
 Frog     9 LHKKQPRVVMMGLDYSGKSTILYKLKINQLVETFPTVGFNVEHIEMSKNVSVTVWDVGGQDKLRP 73

  Fly    76 YWRCYYSNTDAIIYVVDSADRDRIGISKDELLYMLREEELAGAILVVLANKQDMDGCMTVAEVHH 140
            .|:.|..:||.:|:||||:|.||:..:..|||.:|..|.:||...::||||||:...:...|:.|
 Frog    74 NWKEYLEDTDVLIFVVDSSDPDRLPDATAELLSILNNENMAGVPFLILANKQDITDALPAKELKH 138

  Fly   141 ALGLENLKNRTFQIFKTSATKGEGLDQAMDWLSNTLQ 177
            .|.|||..:|.::|...||..||||.:||:.:::.|:
 Frog   139 ILKLENYDDRPWEIQSCSAYTGEGLAEAMNAVASLLK 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl1NP_524098.2 Arl1 18..175 CDD:206718 71/157 (45%)
arl11XP_002935781.1 P-loop_NTPase 15..173 CDD:422963 71/157 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271528at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.