DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment brm and LOC100001344

DIOPT Version :9

Sequence 1:NP_001261906.1 Gene:brm / 39744 FlyBaseID:FBgn0000212 Length:1658 Species:Drosophila melanogaster
Sequence 2:NP_001103696.1 Gene:LOC100001344 / 100001344 -ID:- Length:268 Species:Danio rerio


Alignment Length:282 Identity:86/282 - (30%)
Similarity:140/282 - (49%) Gaps:59/282 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly  1369 LTEKEW--------LKAIDDGAEFDEEEEEDDSKRKRRKRKNRKEESDDDSL--ILKRRRRQNLD 1423
            |:..:|        .:||.:|.....|||.:..|||..::.|:..|:..:.:  :.|||.|...:
Zfish    15 LSPPDWSQPGDHSQSQAIHNGVSEVMEEESNLKKRKSEQQGNQGSETGQEGVEKVKKRRGRPPAE 79

  Fly  1424 K------RSKKQMHKIMSAVIKHNQD-GRTLSEPFMKLPSRQRLPDYYEIIKRPVDIKKILQRIE 1481
            |      :..|||:.|:..||.:... ||.:|:.|::||||:.:|:|||:|::|||.::|.:|:.
Zfish    80 KLPPNPPKLTKQMNTIVDMVINYKDTLGRQISKGFVQLPSRKEVPEYYELIRKPVDFRRIRERVR 144

  Fly  1482 DCKYADLNELEKDFMQLCQNAQIYNEEASLIYLDSIALQKVFVGARQRITAAADAAAVAAGDNTG 1546
            :.||..:.:||||.||:|.|||.:|.|.|.|:.|||.|:.||..|||||        |...:...
Zfish   145 NHKYRCIADLEKDIMQMCHNAQTFNLEGSQIFEDSIVLKSVFESARQRI--------VELSEEDN 201

  Fly  1547 EAHGNGGSDNSDNDDDDGGDDGSDDEEIATTSAAAVKMKLKLNKSLASAPATPTQSSSNVSSGAA 1611
            :|.|:..:|.|.:.|.:.        .::.|:...:..|.:.|::      .|:.|||       
Zfish   202 DAVGSSEADGSHHLDIEA--------PVSETTNPRLDEKKEKNQT------APSNSSS------- 245

  Fly  1612 TTSKKQTRRKRSQKKYTISDDD 1633
                         |:...||:|
Zfish   246 -------------KEVAHSDED 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
brmNP_001261906.1 QLQ 172..202 CDD:214931
Drf_FH1 251..390 CDD:283903
HSA 501..573 CDD:214727
BRK 649..693 CDD:197800
PHA02934 687..>824 CDD:165245
SNF2_N 776..1071 CDD:278600
DEXDc 793..932 CDD:238005
Helicase_C 1097..1212 CDD:278689
SnAC 1304..1375 CDD:291293 2/13 (15%)
Bromo_SNF2L2 1425..1530 CDD:99947 49/105 (47%)
LOC100001344NP_001103696.1 Bromo_SNF2L2 87..193 CDD:99947 49/105 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170596212
Domainoid 1 1.000 92 1.000 Domainoid score I7568
eggNOG 1 0.900 - - E2759_KOG0386
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.