DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17027 and INM1

DIOPT Version :9

Sequence 1:NP_001261909.1 Gene:CG17027 / 39742 FlyBaseID:FBgn0036553 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_011912.1 Gene:INM1 / 856442 SGDID:S000001088 Length:295 Species:Saccharomyces cerevisiae


Alignment Length:279 Identity:86/279 - (30%)
Similarity:124/279 - (44%) Gaps:61/279 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 DIEELYNFIHPLAI-KAGEIL------MEGYEMASKNVSIKGDFYDVVTDYDNKIEDFLMEKILA 65
            |:..:..|:..||. |.|.|:      .:.|::.:.:.|:     |:||..|.::|..:.|.:..
Yeast     4 DLASIEKFLCELATEKVGPIIKSKSGTQKDYDLKTGSRSV-----DIVTAIDKQVEKLIWESVKT 63

  Fly    66 RYPDHKFIGEEETAKNNNVSGELTNAPTWIIDPIDGTSNFIKQIPHVCVSIGLAINKQIVVGVIN 130
            :||..||||||...|...|   :|:.||:||||||||:||:...|..|.|:||.:||:.|||||.
Yeast    64 QYPTFKFIGEESYVKGETV---ITDDPTFIIDPIDGTTNFVHDFPFSCTSLGLTVNKEPVVGVIY 125

  Fly   131 NPVQKKLFTTKLGQGAFCNGKPI-HVSSCESV-----------------------KDANVAYEVS 171
            ||....|.:...|.|...|.|.. :.|..||:                       :.....||..
Yeast   126 NPHINLLVSASKGNGMRVNNKDYDYKSKLESMGSLILNKSVVALQPGSAREGKNFQTKMATYEKL 190

  Fly   172 LL----HVHSVANKHIKRIYHVGLNARRLVAYSCVVDELCMVAAGNLDAFYIEDMYPWDCAAGSL 232
            |.    .||...|        :|.:|..: ||         :|.|.||:::....|.||..||..
Yeast   191 LSCDYGFVHGFRN--------LGSSAMTM-AY---------IAMGYLDSYWDGGCYSWDVCAGWC 237

  Fly   233 LVKEAGGVVTHPFGGPFDI 251
            ::||.||.|.....|.:.|
Yeast   238 ILKEVGGRVVGANPGEWSI 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17027NP_001261909.1 IMPase 12..259 CDD:238817 85/275 (31%)
INM1NP_011912.1 IMPase 10..267 CDD:238817 85/273 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0483
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54074
OrthoFinder 1 1.000 - - FOG0000745
OrthoInspector 1 1.000 - - mtm9175
orthoMCL 1 0.900 - - OOG6_100401
Panther 1 1.100 - - O PTHR20854
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X706
TreeFam 1 0.960 - -
109.780

Return to query results.
Submit another query.