DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17027 and impa1

DIOPT Version :9

Sequence 1:NP_001261909.1 Gene:CG17027 / 39742 FlyBaseID:FBgn0036553 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_001017057.1 Gene:impa1 / 549811 XenbaseID:XB-GENE-1004318 Length:280 Species:Xenopus tropicalis


Alignment Length:272 Identity:99/272 - (36%)
Similarity:153/272 - (56%) Gaps:22/272 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 EELYNFIHPLAIKAGEILMEGYEMASKNVSIKGDFYDVVTDYDNKIEDFLMEKILARYPDHKFIG 74
            :|..:|...:|.|||.::....: ...::.:|....|:||..|.|:|:.|:..|..:||.|.|||
 Frog     6 QESMDFAILIARKAGSVVCAALK-EDVSIMVKSSPADLVTATDQKVEEMLISSIKEKYPSHSFIG 69

  Fly    75 EEETAKNNNVSGELTNAPTWIIDPIDGTSNFIKQIPHVCVSIGLAINKQIVVGVINNPVQKKLFT 139
            ||..|.  .....||:.|||||||||||:||:.:.|.|.||||.|:|||:..||:.:.|:.|::|
 Frog    70 EESVAA--GAGSTLTDNPTWIIDPIDGTTNFVHRFPFVAVSIGFAVNKQVEFGVVYSCVEDKMYT 132

  Fly   140 TKLGQGAFCNGKPIHVSSCESVKDANVAYEVSLLHVHSVANKHIKRIYHVGLNARRLV------- 197
            .:.|:||||||:.:.||..:.:..:.:..|:.       :|::.:.|..|..|..||:       
 Frog   133 GRKGKGAFCNGQKLQVSGQKDITKSMIITELG-------SNRNPEVIKMVLSNMERLLCIPIHGI 190

  Fly   198 -AYSCVVDELCMVAAGNLDAFYIEDMYPWDCAAGSLLVKEAGGVVTHPFGGPFDIMKPDLICAGT 261
             |.......:|:||.|..||:|...::.||.||.|:::.||||||....||.||:|...:|.|.:
 Frog   191 RAVGTAAVNMCLVATGGADAYYEMGIHCWDMAAASVIITEAGGVVLDATGGAFDLMSCRVIAASS 255

  Fly   262 ----EKLRKEIE 269
                |::.||::
 Frog   256 RDIAERIAKELQ 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17027NP_001261909.1 IMPase 12..259 CDD:238817 94/254 (37%)
impa1NP_001017057.1 IMPase 9..254 CDD:238817 94/254 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54074
OrthoDB 1 1.010 - - D406919at33208
OrthoFinder 1 1.000 - - FOG0000745
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR20854
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X706
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
77.030

Return to query results.
Submit another query.