DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17027 and BPNT2

DIOPT Version :9

Sequence 1:NP_001261909.1 Gene:CG17027 / 39742 FlyBaseID:FBgn0036553 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_060283.3 Gene:BPNT2 / 54928 HGNCID:26019 Length:359 Species:Homo sapiens


Alignment Length:269 Identity:62/269 - (23%)
Similarity:99/269 - (36%) Gaps:54/269 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 IKGDFYDVVTDYDNKIEDFLMEKILARYPDHKFIGEE---ETAKNNNVSGELTNAPTWIIDPIDG 101
            :|..|..|..:.:..::....|.||.   ||| |.|:   |......|..|  :...| |||:|.
Human   121 LKTAFPSVQINTEEHVDAADQEVILW---DHK-IPEDILKEVTTPKEVPAE--SVTVW-IDPLDA 178

  Fly   102 TSNFIKQI-PHVCVSIGLAINKQIVVGVINNPVQKKLFTTKLGQGAFCNGKPIHVSSCESVKDAN 165
            |..:.:.: .:|...:.:|:|.:.::|||:.|..:......:..|:       :|.:..|..:..
Human   179 TQEYTEDLRKYVTTMVCVAVNGKPMLGVIHKPFSEYTAWAMVDGGS-------NVKARSSYNEKT 236

  Fly   166 VAYEVSLLHVHSVANKHIKRIYHVGLNARRLVAYSCVVDELCMVAAGN--------LDA------ 216
            ....||..|...|                :.||.....::..::.||.        ||.      
Human   237 PRIVVSRSHSGMV----------------KQVALQTFGNQTTIIPAGGAGYKVLALLDVPDKSQE 285

  Fly   217 ---FYIEDMY--PWDCAAGSLLVKEAGGVVTHPFGGPFDIMKPDLICAG-TEKLRKEIEDLLRKG 275
               .||...|  .||..||:.::|..||.:|...|........|.|..| ...:|...:.|:||.
Human   286 KADLYIHVTYIKKWDICAGNAILKALGGHMTTLSGEEISYTGSDGIEGGLLASIRMNHQALVRKL 350

  Fly   276 DQEESVGGK 284
            ...|..|.|
Human   351 PDLEKTGHK 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17027NP_001261909.1 IMPase 12..259 CDD:238817 54/241 (22%)
BPNT2NP_060283.3 IPPase 66..349 CDD:238818 57/257 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 86..106
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144799
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.