DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17027 and CG7789

DIOPT Version :9

Sequence 1:NP_001261909.1 Gene:CG17027 / 39742 FlyBaseID:FBgn0036553 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_651728.1 Gene:CG7789 / 43516 FlyBaseID:FBgn0039698 Length:306 Species:Drosophila melanogaster


Alignment Length:269 Identity:58/269 - (21%)
Similarity:104/269 - (38%) Gaps:72/269 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 AIKAGEILMEGYEMASKNVSIKGDFYDVVTDYDNKIEDFLMEKILARYPDHKFIGEEETAKNNNV 84
            |.:||.|:.:..:.....:..||. .|..|:.|...:..::..:..::|..|.||||..:..|..
  Fly    19 AKRAGGIIRDVLKKGDLGIVDKGK-NDPQTEADRSAQRCIIASLAKKFPTVKIIGEEGGSDLNVC 82

  Fly    85 SGELTN----------APT------------WIIDPIDGTSNFIK-QIPHVCVSIGLAINKQIVV 126
            ...|.|          .|.            | :||:|||:.:.: .:.||.|.||:|:....|.
  Fly    83 DDWLVNELDEEFLQHSCPAEWKDVKPEDFVIW-VDPLDGTAEYTQGHVEHVTVLIGIAVKDAAVG 146

  Fly   127 GVINNP--------VQKKLFTTK-LGQGAFC-----NGKPIHVSSCESVKDANVAYEVSLLH--- 174
            |:|:.|        :.:.::..| ||.|.|.     .|:.| :::..|..:|        ||   
  Fly   147 GIIHQPFYQQPDGEMGRTIWGLKGLGTGGFTAVPAPAGQFI-ITTTRSHSNA--------LHQQA 202

  Fly   175 VHSVANKHIKRIYHVGLNARRLV-----AYSCVVDELCMVAAGNLDAFYIEDMYPWDCAAGSLLV 234
            :::.|:..:.::...|....:|:     ||                .|.......||..|...::
  Fly   203 LNAFASTEVLKVGGAGFKVLQLLEGKAHAY----------------VFATPGCKKWDTCAPEAVL 251

  Fly   235 KEAGGVVTH 243
            :..||.:|:
  Fly   252 EAQGGCLTN 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17027NP_001261909.1 IMPase 12..259 CDD:238817 58/269 (22%)
CG7789NP_651728.1 IPPase 12..294 CDD:238818 58/269 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445174
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.