DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17027 and CG15743

DIOPT Version :9

Sequence 1:NP_001261909.1 Gene:CG17027 / 39742 FlyBaseID:FBgn0036553 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_001259511.1 Gene:CG15743 / 32279 FlyBaseID:FBgn0030465 Length:355 Species:Drosophila melanogaster


Alignment Length:267 Identity:58/267 - (21%)
Similarity:100/267 - (37%) Gaps:60/267 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 DVVTDYDNKIEDFLMEKILARYPDHKFIGEE-------------------ETAKNNNVSGELTNA 91
            |..||.|.:....:.:.:...:|..:...||                   |||:..:|:....:.
  Fly    98 DPFTDADGRSHCVMKQGLQRIFPRVQIFSEEDKEHCKQAHGYDLDPTVLHETAQIPDVTVNAQDV 162

  Fly    92 PTWIIDPIDGTSNFIKQI-PHVCVSIGLAINKQIVVGVINNPVQKKLFTTKLGQGAFC------- 148
            ..| :||:|.|..|.::: .:|...:.:|:..:.::|||::|..        ||.|:.       
  Fly   163 TVW-VDPLDATKEFTEELYEYVTTMVCVAVAGRPIIGVIHSPFN--------GQTAWAWVGNSMS 218

  Fly   149 ----NGKPIHVSSCESVKDANVAYEVSLLHVHSVANKHIKR-IYHVGLNARRLVAYSCVVDELCM 208
                |..|.|..:       |.|..:::...|:...|.:.| |:  |.|...|.|..... ::..
  Fly   219 EYLSNLHPQHSPN-------NQAPIITVSRSHTAGAKDLARGIF--GENVSLLTAAGAGY-KVLQ 273

  Fly   209 VAAGNLDAF-YIEDMYPWDCAAGSLLVKEAGGVVTHPFGGPFDIMKPDLICAGTEKLRKEIEDLL 272
            |.|.|..|: :...:..||..||.        .:.|..||....:...||..|.|:.....|.||
  Fly   274 VVANNATAYLHTSKIKKWDICAGD--------AILHALGGTMTTLNDQLINYGPEESPVNTEGLL 330

  Fly   273 RKGDQEE 279
            ...:|.:
  Fly   331 ATLEQHD 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17027NP_001261909.1 IMPase 12..259 CDD:238817 52/245 (21%)
CG15743NP_001259511.1 IPPase 59..342 CDD:238818 58/267 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445186
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.