DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17027 and Bpnt2

DIOPT Version :9

Sequence 1:NP_001261909.1 Gene:CG17027 / 39742 FlyBaseID:FBgn0036553 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_001008772.2 Gene:Bpnt2 / 312952 RGDID:1306455 Length:356 Species:Rattus norvegicus


Alignment Length:274 Identity:61/274 - (22%)
Similarity:104/274 - (37%) Gaps:68/274 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 ASKNVSIKGDFYDVVTD-----YDNKIEDFLMEKILARYPDHKFIGEEETAKNNNVSGELTNAPT 93
            |..||.|..:.:...:|     ::.||.:.::::|.|        .:|..|::..|         
  Rat   122 AFPNVQINTEEHVDASDKEVIVWNRKIPEDILKEIAA--------PKEVPAESVTV--------- 169

  Fly    94 WIIDPIDGTSNFIKQI-PHVCVSIGLAINKQIVVGVINNPVQKKLFTTKLGQGAFCNGKPIHVSS 157
            | |||:|.|..:.:.: .:|...:.:|:|.:.|:|||:.|..:......:..|:       :|.:
  Rat   170 W-IDPLDATQEYTEDLRKYVTTMVCVAVNGKPVLGVIHKPFSEYTAWAMVDSGS-------NVKA 226

  Fly   158 CESVKDANVAYEVSLLHVHSVANKHIKRIYHVGLNARRLVAYSCVVDELCMVAAGN--------L 214
            ..|..:......||..|...|                :.||.....::..::.||.        |
  Rat   227 RSSYNEKTPKIIVSRSHAGMV----------------KQVALQTFGNQTLIIPAGGAGYKVLALL 275

  Fly   215 DA---------FYIEDMY--PWDCAAGSLLVKEAGGVVTHPFGGPFDIMKPDLICAG-TEKLRKE 267
            |.         .||...|  .||..||:.::|..||.:|...|........|.|..| ...:|..
  Rat   276 DVPDMTQEKADLYIHVTYIKKWDICAGNAILKALGGHMTTLSGEEISYTGSDGIEGGLLASIRMN 340

  Fly   268 IEDLLRK-GDQEES 280
            .:.|:|| .|.|:|
  Rat   341 HQALVRKLPDLEKS 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17027NP_001261909.1 IMPase 12..259 CDD:238817 53/249 (21%)
Bpnt2NP_001008772.2 IPPase 64..347 CDD:238818 56/265 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 82..104
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338495
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.