DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17027 and Impa2

DIOPT Version :9

Sequence 1:NP_001261909.1 Gene:CG17027 / 39742 FlyBaseID:FBgn0036553 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_757378.1 Gene:Impa2 / 282636 RGDID:628692 Length:290 Species:Rattus norvegicus


Alignment Length:285 Identity:100/285 - (35%)
Similarity:167/285 - (58%) Gaps:34/285 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 EELYNFIHP----------LAIKAGEILMEGYEMASKNVSIKGDFYDVVTDYDNKIEDFLMEKIL 64
            |||...:.|          ||::||:|:.:.. ...|:||.|....|:||:.|:::||.::.::.
  Rat     9 EELVQGVGPWDECFEVAVQLALRAGQIIRKAL-TEEKHVSTKTSAADLVTETDHRVEDLIVSELR 72

  Fly    65 ARYPDHKFIGEEETAKNNNVSGE---LTNAPTWIIDPIDGTSNFIKQIPHVCVSIGLAINKQIVV 126
            .|:|.|:||.||.||     ||.   ||::|||||||||||.||:.:.|.|.||||.|:::::..
  Rat    73 KRFPSHRFIAEEATA-----SGAKCVLTHSPTWIIDPIDGTCNFVHRFPTVAVSIGFAVHQELEF 132

  Fly   127 GVINNPVQKKLFTTKLGQGAFCNGKPIHVSSCESVKDANVAYEVSLLHVH--------SVANKHI 183
            |||::..:::|:|.:.||||||||:.:.||     ::.::|..:.|..:.        .|...::
  Rat   133 GVIHHCTEERLYTGRRGQGAFCNGQRLQVS-----RETDLAKALVLTEIGPKRDPDTLKVFLSNM 192

  Fly   184 KRIYHVGLNARRLVAYSCVVDELCMVAAGNLDAFYIEDMYPWDCAAGSLLVKEAGGVVTHPFGGP 248
            :|:.|...:..|::..|.:.  ||.:|:|..||:|...::.||.||.:::::||||:|....|||
  Rat   193 ERLLHAKAHGVRVIGSSTLA--LCYLASGAADAYYQFGLHCWDLAAATVIIREAGGIVIDTSGGP 255

  Fly   249 FDIMKPDLICAGTEKLRKEIEDLLR 273
            .|:|...::.|||.::...|...|:
  Rat   256 LDLMSCRVVAAGTREMAVLIAQALQ 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17027NP_001261909.1 IMPase 12..259 CDD:238817 93/267 (35%)
Impa2NP_757378.1 IMPase 21..266 CDD:238817 91/257 (35%)
Substrate binding. /evidence=ECO:0000250 105..108 2/2 (100%)
Substrate binding. /evidence=ECO:0000250 207..209 0/1 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338500
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0483
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54074
OrthoDB 1 1.010 - - D406919at33208
OrthoFinder 1 1.000 - - FOG0000745
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100401
Panther 1 1.100 - - O PTHR20854
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X706
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.720

Return to query results.
Submit another query.