DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17027 and tol1

DIOPT Version :9

Sequence 1:NP_001261909.1 Gene:CG17027 / 39742 FlyBaseID:FBgn0036553 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_588230.1 Gene:tol1 / 2538954 PomBaseID:SPCC1753.04 Length:353 Species:Schizosaccharomyces pombe


Alignment Length:234 Identity:53/234 - (22%)
Similarity:92/234 - (39%) Gaps:57/234 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 LMEKILARYPDHKFIGEEETAK-------NNNVSGELTNAPTWIIDPIDGTSNFIKQIPHVCVSI 116
            |:::.:....::|.:|:.::|:       ..:..|. .|...|.:||||||..|::...: .:.:
pombe    92 LVQETIQHATEYKELGQIKSAEEMMSIIDQGSYHGG-RNGRMWTLDPIDGTKGFLRGAQY-AICL 154

  Fly   117 GLAINKQIVVGVINNP--------------------------VQKKLFTTKLGQGAFCNGKP--I 153
            .|..|.:.||..|..|                          .|..|...||        :|  :
pombe   155 ALIENGKPVVSAIGCPNLPYDFNQPETSPKGIIMSAVRNHGCFQYSLHNEKL--------EPVQV 211

  Fly   154 HVSSCESVKDANVAYEVSLLHVHSVANKHIKRIYHVGLNARRLVAYSCVVDELCMVAAGNLDAFY 218
            |:...::.||:.....|...|......:.|.:...:.....::.:.:    :...:|.|:.|.:.
pombe   212 HMQDVQNTKDSKFCEGVEAGHSMQGTQEEIAKYLGITRGPTKMDSQA----KYASLARGDGDIYL 272

  Fly   219 -------IEDMYPWDCAAGSLLVKEAGGVVTHPFGGPFD 250
                   .|:.. ||.|.|||||:||||||:..||.|.|
pombe   273 RLPTKMTFEEKI-WDHAGGSLLVEEAGGVVSDMFGKPLD 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17027NP_001261909.1 IMPase 12..259 CDD:238817 53/234 (23%)
tol1NP_588230.1 bisphos_HAL2 2..352 CDD:273558 53/234 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 47 1.000 Domainoid score I3498
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 47 1.000 Inparanoid score I2070
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto100628
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.