DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17028 and INM2

DIOPT Version :9

Sequence 1:NP_001189114.1 Gene:CG17028 / 39741 FlyBaseID:FBgn0036552 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_010573.3 Gene:INM2 / 851881 SGDID:S000002695 Length:292 Species:Saccharomyces cerevisiae


Alignment Length:245 Identity:94/245 - (38%)
Similarity:129/245 - (52%) Gaps:23/245 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LEVYYQVSLELVR-KCGPLFLEGFQKPKTDYEVKSAFYDLVTVYDKQIEATLTDGLLKTFPESKI 73
            ||......:||:| |.|||...........|:.|:...||||..|||||:.:.:.|...:|..|.
Yeast     8 LEEVENTFIELLRSKIGPLVKSHAGTNFCSYDDKANGVDLVTALDKQIESIIKENLTAKYPSFKF 72

  Fly    74 IGEEAMANAKTPPELTDAPTWIIDPIDGTNNYVRKIPHCCISVGLAINKELVLGIVYNPSANELY 138
            ||||......|  ::|:.||:|:||||||.|::...|:.|.|:|||...:.|:|:|:||..|:|:
Yeast    73 IGEETYVKGVT--KITNGPTFIVDPIDGTTNFIHGYPYSCTSLGLAEMGKPVVGVVFNPHLNQLF 135

  Fly   139 SAWQGHGAYLNGQPIEVSNAKKINQALVCYEISLIVVSKGR----------DKNVKRLYKLASSA 193
            .|.:|:||:||.|.|:||....|.|.      |||.:..|.          ||.:.....|.|.:
Yeast   136 HASKGNGAFLNDQEIKVSKRPLILQK------SLIALEGGSERTEGSQGNFDKKMNTYKNLLSES 194

  Fly   194 ----TGTRSFGCAALTLCYIAAGRCDAYHVENLKPWDLAGGAVILREAGG 239
                .|.||.|.||:.:||:|:|..|||.......||:..|..||.||||
Yeast   195 GAFVHGFRSAGSAAMNICYVASGMLDAYWEGGCWAWDVCAGWCILEEAGG 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17028NP_001189114.1 IMPase 13..260 CDD:238817 92/242 (38%)
INM2NP_010573.3 IMPase 13..265 CDD:238817 92/240 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 169 1.000 Domainoid score I783
eggNOG 1 0.900 - - E1_COG0483
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 169 1.000 Inparanoid score I1019
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54074
OrthoFinder 1 1.000 - - FOG0000745
OrthoInspector 1 1.000 - - mtm9175
orthoMCL 1 0.900 - - OOG6_100401
Panther 1 1.100 - - O PTHR20854
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X706
TreeFam 1 0.960 - -
1110.920

Return to query results.
Submit another query.