DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17028 and IMPL1

DIOPT Version :9

Sequence 1:NP_001189114.1 Gene:CG17028 / 39741 FlyBaseID:FBgn0036552 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_564376.1 Gene:IMPL1 / 840007 AraportID:AT1G31190 Length:371 Species:Arabidopsis thaliana


Alignment Length:292 Identity:87/292 - (29%)
Similarity:130/292 - (44%) Gaps:54/292 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LEVYYQVSLELVRKCG-PLFLEGFQKPKT-DYEVKSAFYDLVTVYDKQIEATLTDGLLKTFPESK 72
            |||     :||..|.| .:.:|...||:. .|:..|   ||||..||..||.:.:.:.|.|.:..
plant    88 LEV-----VELAAKTGAEVVMEAVNKPRNITYKGLS---DLVTDTDKASEAAILEVVKKNFSDHL 144

  Fly    73 IIGEEAMANAKTPPELTDAPTWIIDPIDGTNNYVRKIPHCCISVGLAINKELVLGIVY--NPSA- 134
            |:|||......:..:.    .|.|||:|||.|:....|...:||          |::|  ||:| 
plant   145 ILGEEGGIIGDSSSDY----LWCIDPLDGTTNFAHGYPSFAVSV----------GVLYRGNPAAA 195

  Fly   135 -------------NELYSAWQGHGAYLNGQPIEVSNAKKINQALVCYEISLIVVSKGRD------ 180
                         ...:||..|.||..|||.|.||....:.:|       |::...|.:      
plant   196 SVVEFVGGPMCWNTRTFSATAGGGALCNGQKIHVSKTDAVERA-------LLITGFGYEHDDAWS 253

  Fly   181 KNVKRLYKLASSATGTRSFGCAALTLCYIAAGRCDAYHVENLKPWDLAGGAVILREAGGRVYHTS 245
            .|::...:....:.|.|..|.||:.:|::|.|..::|....|||||:|.|.:|:.||||.|....
plant   254 TNMELFKEFTDVSRGVRRLGAAAVDMCHVALGIAESYWEYRLKPWDMAAGVLIVEEAGGAVTRMD 318

  Fly   246 GARFDVMKPDCVCTSSEELAKSVIQLIEGADQ 277
            |.:|.|.... |..|:..|...:::.|..|.:
plant   319 GGKFSVFDRS-VLVSNGVLHPKLLERIAPATE 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17028NP_001189114.1 IMPase 13..260 CDD:238817 80/270 (30%)
IMPL1NP_564376.1 PLN02737 11..371 CDD:215392 87/292 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0483
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D915621at2759
OrthoFinder 1 1.000 - - FOG0000745
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100401
Panther 1 1.100 - - O PTHR20854
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.870

Return to query results.
Submit another query.