DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17028 and VTC4

DIOPT Version :9

Sequence 1:NP_001189114.1 Gene:CG17028 / 39741 FlyBaseID:FBgn0036552 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_186936.1 Gene:VTC4 / 821206 AraportID:AT3G02870 Length:271 Species:Arabidopsis thaliana


Alignment Length:271 Identity:100/271 - (36%)
Similarity:142/271 - (52%) Gaps:20/271 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 EKLEVYYQVSLELVRKCGPLFLEGFQKPKTDYEVKSAFY----DLVTVYDKQIEATLTDGLLKTF 68
            :.|:.:...:::..:|.|.:..:||      ||.|...:    ||||..||..|..:.:.|.:.|
plant     5 DSLDQFLAAAIDAAKKAGQIIRKGF------YETKHVEHKGQVDLVTETDKGCEELVFNHLKQLF 63

  Fly    69 PESKIIGEEAMANAKTPPELTDAPTWIIDPIDGTNNYVRKIPHCCISVGLAINKELVLGIVYNPS 133
            |..|.||||..| |....||||.||||:||:|||.|:|...|..|:|:||.|.|..|:|:||||.
plant    64 PNHKFIGEETTA-AFGVTELTDEPTWIVDPLDGTTNFVHGFPFVCVSIGLTIGKVPVVGVVYNPI 127

  Fly   134 ANELYSAWQGHGAYLNGQPIEVSNAKKINQALVCYEISLIVVSKGRDKNVKRLYKLASSATGTRS 198
            ..||::..||.||:|||:.|:||...::..||:..|..........|....|:..|.:.....|.
plant   128 MEELFTGVQGKGAFLNGKRIKVSAQSELLTALLVTEAGTKRDKATLDDTTNRINSLLTKVRSLRM 192

  Fly   199 FGCAALTLCYIAAGRCDAYHVENL-KPWDLAGGAVILREAGGRVYHTSGARFDVMKPDCVCTSSE 262
            .|..||.||.:|.||.|.::.... .|||:|.|.||::||||.::..||...|:        :|:
plant   193 SGSCALDLCGVACGRVDIFYELGFGGPWDIAAGIVIVKEAGGLIFDPSGKDLDI--------TSQ 249

  Fly   263 ELAKSVIQLIE 273
            .:|.|...|.|
plant   250 RIAASNASLKE 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17028NP_001189114.1 IMPase 13..260 CDD:238817 94/251 (37%)
VTC4NP_186936.1 PLN02553 1..269 CDD:178168 100/271 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0483
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54074
OrthoDB 1 1.010 - - D915621at2759
OrthoFinder 1 1.000 - - FOG0000745
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100401
Panther 1 1.100 - - O PTHR20854
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X706
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.880

Return to query results.
Submit another query.