DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17028 and impa1

DIOPT Version :9

Sequence 1:NP_001189114.1 Gene:CG17028 / 39741 FlyBaseID:FBgn0036552 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001017057.1 Gene:impa1 / 549811 XenbaseID:XB-GENE-1004318 Length:280 Species:Xenopus tropicalis


Alignment Length:278 Identity:97/278 - (34%)
Similarity:156/278 - (56%) Gaps:24/278 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LEVYYQVSLE----LVRKCGPLFLEGFQKPKTDYEVKSAFYDLVTVYDKQIEATLTDGLLKTFPE 70
            :|..:|.|::    :.||.|.:..... |......|||:..||||..|:::|..|...:.:.:|.
 Frog     1 MEDQWQESMDFAILIARKAGSVVCAAL-KEDVSIMVKSSPADLVTATDQKVEEMLISSIKEKYPS 64

  Fly    71 SKIIGEEAMANAKTPPELTDAPTWIIDPIDGTNNYVRKIPHCCISVGLAINKELVLGIVYNPSAN 135
            ...||||::| |.....|||.|||||||||||.|:|.:.|...:|:|.|:||::..|:||:...:
 Frog    65 HSFIGEESVA-AGAGSTLTDNPTWIIDPIDGTTNFVHRFPFVAVSIGFAVNKQVEFGVVYSCVED 128

  Fly   136 ELYSAWQGHGAYLNGQPIEVSNAKKINQALVCYEIS--------LIVVSKGRDKNVKRLYKLASS 192
            ::|:..:|.||:.|||.::||..|.|.::::..|:.        .:|:|     |::||  |...
 Frog   129 KMYTGRKGKGAFCNGQKLQVSGQKDITKSMIITELGSNRNPEVIKMVLS-----NMERL--LCIP 186

  Fly   193 ATGTRSFGCAALTLCYIAAGRCDAYHVENLKPWDLAGGAVILREAGGRVYHTSGARFDVMKPDCV 257
            ..|.|:.|.||:.:|.:|.|..|||:...:..||:|..:||:.||||.|...:|..||:|....:
 Frog   187 IHGIRAVGTAAVNMCLVATGGADAYYEMGIHCWDMAAASVIITEAGGVVLDATGGAFDLMSCRVI 251

  Fly   258 CTSSEELAKSV---IQLI 272
            ..||.::|:.:   :|:|
 Frog   252 AASSRDIAERIAKELQII 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17028NP_001189114.1 IMPase 13..260 CDD:238817 91/258 (35%)
impa1NP_001017057.1 IMPase 9..254 CDD:238817 89/253 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54074
OrthoDB 1 1.010 - - D406919at33208
OrthoFinder 1 1.000 - - FOG0000745
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR20854
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X706
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
66.120

Return to query results.
Submit another query.