DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17028 and CG7789

DIOPT Version :9

Sequence 1:NP_001189114.1 Gene:CG17028 / 39741 FlyBaseID:FBgn0036552 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_651728.1 Gene:CG7789 / 43516 FlyBaseID:FBgn0039698 Length:306 Species:Drosophila melanogaster


Alignment Length:238 Identity:50/238 - (21%)
Similarity:83/238 - (34%) Gaps:50/238 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 DLVTVYDKQIEATLTDGLLKTFPESKIIGEEAMANAKT------------------PPELTDAP- 92
            |..|..|:..:..:...|.|.||..||||||..::...                  |.|..|.. 
  Fly    44 DPQTEADRSAQRCIIASLAKKFPTVKIIGEEGGSDLNVCDDWLVNELDEEFLQHSCPAEWKDVKP 108

  Fly    93 ----TWIIDPIDGTNNYVR-KIPHCCISVGLAINKELVLGIVYNPSANELY---------SAWQG 143
                .| :||:|||..|.: .:.|..:.:|:|:....|.||::.|    .|         :.|..
  Fly   109 EDFVIW-VDPLDGTAEYTQGHVEHVTVLIGIAVKDAAVGGIIHQP----FYQQPDGEMGRTIWGL 168

  Fly   144 HGAYLNGQPIEVSNAKKINQALVCYEISLIVVSKGRDKNVKRLYKLASSATGTRSFGCAALTLCY 208
            .|....|.....:.|.:.          :|..::.....:.:....|.::|.....|.|...:..
  Fly   169 KGLGTGGFTAVPAPAGQF----------IITTTRSHSNALHQQALNAFASTEVLKVGGAGFKVLQ 223

  Fly   209 IAAGRCDAY--HVENLKPWDLAGGAVILREAGGRVYHTSGARF 249
            :..|:..||  .....|.||......:|...||.:.:.:|..:
  Fly   224 LLEGKAHAYVFATPGCKKWDTCAPEAVLEAQGGCLTNINGEHY 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17028NP_001189114.1 IMPase 13..260 CDD:238817 50/238 (21%)
CG7789NP_651728.1 IPPase 12..294 CDD:238818 50/238 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445173
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.