DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17028 and CG17026

DIOPT Version :9

Sequence 1:NP_001189114.1 Gene:CG17028 / 39741 FlyBaseID:FBgn0036552 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_648820.1 Gene:CG17026 / 39739 FlyBaseID:FBgn0036550 Length:284 Species:Drosophila melanogaster


Alignment Length:273 Identity:121/273 - (44%)
Similarity:177/273 - (64%) Gaps:2/273 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 EEKLEVYYQVSLELVRKCGPLFLEGFQKPKTDYEVKSA-FYDLVTVYDKQIEATLTDGLLKTFPE 70
            :.::|..|.....|..:.|.:.|||:|.......:|.. ||::||.||.|||..|.:.:|..:|:
  Fly     5 KSQIEELYDFIYPLAVRAGEILLEGYQNAGKAVALKDGEFYNVVTAYDNQIEEFLVEKILARYPD 69

  Fly    71 SKIIGEE-AMANAKTPPELTDAPTWIIDPIDGTNNYVRKIPHCCISVGLAINKELVLGIVYNPSA 134
            .|.|||| ...|.....||||||||||||||||:|::::|||..:|:||:|.|::|||:|.||:.
  Fly    70 HKFIGEEDTHKNDNVTKELTDAPTWIIDPIDGTSNFIKQIPHVSVSIGLSIKKQIVLGVVNNPAQ 134

  Fly   135 NELYSAWQGHGAYLNGQPIEVSNAKKINQALVCYEISLIVVSKGRDKNVKRLYKLASSATGTRSF 199
            |:||:|..|.||:.||:||:||:.:.:|.|.|.||:.|:...|.|:|::||:|.:.|:|....::
  Fly   135 NKLYTAKLGQGAFCNGKPIQVSSCEHLNDANVAYEVCLLHAPKIRNKHIKRIYHVGSNARRLLAY 199

  Fly   200 GCAALTLCYIAAGRCDAYHVENLKPWDLAGGAVILREAGGRVYHTSGARFDVMKPDCVCTSSEEL 264
            .....:||.:|||..||:|:|::.|||.|.|.:::|||||.|.|..|..||:||||.:|..:|.|
  Fly   200 SAVVDSLCMVAAGNLDAFHIEDMYPWDCAAGYLLIREAGGVVTHPYGGPFDIMKPDLICAGTETL 264

  Fly   265 AKSVIQLIEGADQ 277
            ...:..||..|||
  Fly   265 RAEIEHLIRKADQ 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17028NP_001189114.1 IMPase 13..260 CDD:238817 113/248 (46%)
CG17026NP_648820.1 IMPase 11..259 CDD:238817 112/247 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469792
Domainoid 1 1.000 47 1.000 Domainoid score I3498
eggNOG 1 0.900 - - E1_COG0483
Homologene 1 1.000 - - H120058
Inparanoid 1 1.050 47 1.000 Inparanoid score I2070
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D107379at33392
OrthoFinder 1 1.000 - - FOG0000745
OrthoInspector 1 1.000 - - otm51346
orthoMCL 1 0.900 - - OOG6_100401
Panther 1 1.100 - - P PTHR20854
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
109.890

Return to query results.
Submit another query.