DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17028 and IMPA2

DIOPT Version :9

Sequence 1:NP_001189114.1 Gene:CG17028 / 39741 FlyBaseID:FBgn0036552 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_055029.1 Gene:IMPA2 / 3613 HGNCID:6051 Length:288 Species:Homo sapiens


Alignment Length:272 Identity:101/272 - (37%)
Similarity:149/272 - (54%) Gaps:19/272 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 EVYYQVSLELVRKCGPLFLEGFQKPKTDYEVKSAFYDLVTVYDKQIEATLTDGLLKTFPESKIIG 75
            |..:|.:::|..:.|.:..:...:.|. ...|::..||||..|..:|..:...|.:.||..:.|.
Human    17 EECFQAAVQLALRAGQIIRKALTEEKR-VSTKTSAADLVTETDHLVEDLIISELRERFPSHRFIA 80

  Fly    76 EEAMAN-AKTPPELTDAPTWIIDPIDGTNNYVRKIPHCCISVGLAINKELVLGIVYNPSANELYS 139
            |||.|: ||.  .||.:|||||||||||.|:|.:.|...:|:|.|:.:||..|::|:.:...||:
Human    81 EEAAASGAKC--VLTHSPTWIIDPIDGTCNFVHRFPTVAVSIGFAVRQELEFGVIYHCTEERLYT 143

  Fly   140 AWQGHGAYLNGQPIEVSNAKKINQALVCYEISLIVVSKGRD--------KNVKRLYKLASSATGT 196
            ..:|.||:.|||.:.||....:::|||..||     ...||        .|::||  |.:.|.|.
Human   144 GRRGRGAFCNGQRLRVSGETDLSKALVLTEI-----GPKRDPATLKLFLSNMERL--LHAKAHGV 201

  Fly   197 RSFGCAALTLCYIAAGRCDAYHVENLKPWDLAGGAVILREAGGRVYHTSGARFDVMKPDCVCTSS 261
            |..|.:.|.||::|:|..|||:...|..||||...||:|||||.|..|||...|:|....|..|:
Human   202 RVIGSSTLALCHLASGAADAYYQFGLHCWDLAAATVIIREAGGIVIDTSGGPLDLMACRVVAAST 266

  Fly   262 EELAKSVIQLIE 273
            .|:|..:.|.::
Human   267 REMAMLIAQALQ 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17028NP_001189114.1 IMPase 13..260 CDD:238817 96/255 (38%)
IMPA2NP_055029.1 IMPase 19..265 CDD:238817 96/255 (38%)
Substrate binding 103..106 2/2 (100%)
Substrate binding 205..207 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144802
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0483
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54074
OrthoDB 1 1.010 - - D406919at33208
OrthoFinder 1 1.000 - - FOG0000745
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100401
Panther 1 1.100 - - O PTHR20854
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X706
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
98.810

Return to query results.
Submit another query.