DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17028 and CG15743

DIOPT Version :9

Sequence 1:NP_001189114.1 Gene:CG17028 / 39741 FlyBaseID:FBgn0036552 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001259511.1 Gene:CG15743 / 32279 FlyBaseID:FBgn0030465 Length:355 Species:Drosophila melanogaster


Alignment Length:282 Identity:67/282 - (23%)
Similarity:109/282 - (38%) Gaps:58/282 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 KPKTDYEVKSAFYDLVTVYDKQIEATLTDGLLKTFPESKIIGEEAMANAKTP------------- 85
            |.|||..|...|.|.    |.:....:..||.:.||..:|..||...:.|..             
  Fly    89 KGKTDEGVNDPFTDA----DGRSHCVMKQGLQRIFPRVQIFSEEDKEHCKQAHGYDLDPTVLHET 149

  Fly    86 ---PELT----DAPTWIIDPIDGTNNYVRKI-PHCCISVGLAINKELVLGIVYNPSANELYSAWQ 142
               |::|    |...| :||:|.|..:..:: .:....|.:|:....::|::::|...:...||.
  Fly   150 AQIPDVTVNAQDVTVW-VDPLDATKEFTEELYEYVTTMVCVAVAGRPIIGVIHSPFNGQTAWAWV 213

  Fly   143 GH--GAYL-NGQPIEVSNAKKINQALVCYEISLIVVSKGRDKNVKRLYK---------LASSATG 195
            |:  ..|| |..|....|    |||      .:|.||:......|.|.:         |.::..|
  Fly   214 GNSMSEYLSNLHPQHSPN----NQA------PIITVSRSHTAGAKDLARGIFGENVSLLTAAGAG 268

  Fly   196 TRSFGCAALTLCYIAAGRCDAY-HVENLKPWDLAGGAVILREAGGRVYHTSGARFDVMKPDCVCT 259
            .:        :..:.|....|| |...:|.||:..|..||...||.: .|...:.....|:....
  Fly   269 YK--------VLQVVANNATAYLHTSKIKKWDICAGDAILHALGGTM-TTLNDQLINYGPEESPV 324

  Fly   260 SSEELAKSVIQLIEGADQISGY 281
            ::|.|..::.|..|..|::|.|
  Fly   325 NTEGLLATLEQHDEYMDKLSKY 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17028NP_001189114.1 IMPase 13..260 CDD:238817 60/259 (23%)
CG15743NP_001259511.1 IPPase 59..342 CDD:238818 64/276 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445185
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3073
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.880

Return to query results.
Submit another query.