DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17028 and Bpnt2

DIOPT Version :9

Sequence 1:NP_001189114.1 Gene:CG17028 / 39741 FlyBaseID:FBgn0036552 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_808398.1 Gene:Bpnt2 / 242291 MGIID:1915720 Length:356 Species:Mus musculus


Alignment Length:266 Identity:65/266 - (24%)
Similarity:112/266 - (42%) Gaps:69/266 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 KTDYEVKSAFYDLVTVYDKQIEATLTDGLL--KTFPESKIIGEEAMANAKTPPELTDAPTWIIDP 98
            |..|.:|:||.::....::.::|:..:.::  :..||.  |.:|..|..:.|.|  ....| |||
Mouse   114 KMFYLLKTAFPNVQINTEEHVDASDKEVIVWNRKIPED--ILKEIAAPKEVPAE--SVTVW-IDP 173

  Fly    99 IDGTNNYVRKI-PHCCISVGLAINKELVLGIVYNPSANELYSAWQGHGAYLNGQPIEVSNAKKIN 162
            :|.|..|...: .:....|.:|:|.:.|||:::.|.:.  |:||    |.::|.    ||.|   
Mouse   174 LDATQEYTEDLRKYVTTMVCVAVNGKPVLGVIHKPFSE--YTAW----AMVDGG----SNVK--- 225

  Fly   163 QALVCY--EISLIVVSKGRDKNVKRLYKLASSATGTRSFG---------------CAALTLCYIA 210
             |...|  :...|:||:.....||::        ..::||               .|.|.:..:.
Mouse   226 -ARSSYNEKTPKIIVSRSHAGMVKQV--------ALQTFGNQTSIIPAGGAGYKVLALLDVPDMT 281

  Fly   211 AGRCDAY-HVENLKPWDLAGGAVILREAGGRVYHTSGARFDVMKPDCVCTSSEELAKSVIQLIEG 274
            ..:.|.| ||..:|.||:..|..||:..||.:...:|               ||::.:      |
Mouse   282 QEKADLYIHVTYIKKWDICAGNAILKALGGHMTTLNG---------------EEISYT------G 325

  Fly   275 ADQISG 280
            :|.|.|
Mouse   326 SDGIEG 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17028NP_001189114.1 IMPase 13..260 CDD:238817 59/244 (24%)
Bpnt2NP_808398.1 IPPase 64..347 CDD:238818 65/266 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 84..104
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834910
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3073
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.880

Return to query results.
Submit another query.