DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17029 and IMPL1

DIOPT Version :9

Sequence 1:NP_001261908.1 Gene:CG17029 / 39740 FlyBaseID:FBgn0036551 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_564376.1 Gene:IMPL1 / 840007 AraportID:AT1G31190 Length:371 Species:Arabidopsis thaliana


Alignment Length:267 Identity:85/267 - (31%)
Similarity:124/267 - (46%) Gaps:38/267 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SSAVSESKLKEYYDVALKLVLKCGPLMQEGYQKAKT-EYKVKADFYDLVTVYDKQIEDILTEGLV 65
            :..:|.:.|.|..::|.|...:   ::.|...|.:. .||   ...||||..||..|..:.|.:.
plant    79 TGTISPAHLLEVVELAAKTGAE---VVMEAVNKPRNITYK---GLSDLVTDTDKASEAAILEVVK 137

  Fly    66 AAFPESLIIGEEESAVSQRQAELTDAPTWIIDPIDGTTNFIHRIPHCCISVGLAINKELVVGIIY 130
            ..|.:.||:|||...:....::.    .|.|||:||||||.|..|...:|          ||::|
plant   138 KNFSDHLILGEEGGIIGDSSSDY----LWCIDPLDGTTNFAHGYPSFAVS----------VGVLY 188

  Fly   131 --NPPA--------------NELFSAYKGHGAYLNGEPIHTSKVTTIKQAVIAYEISLIHAAGVR 179
              ||.|              ...|||..|.||..||:.||.||...:::|::.......| ....
plant   189 RGNPAAASVVEFVGGPMCWNTRTFSATAGGGALCNGQKIHVSKTDAVERALLITGFGYEH-DDAW 252

  Fly   180 DKNVKRLYKMASNATGTRCFGSAALTLCYVATGQCDAYHVEDLKPWDIAAGAIILTEAGGTVCHT 244
            ..|::...:....:.|.|..|:||:.:|:||.|..::|....|||||:|||.:|:.||||.|...
plant   253 STNMELFKEFTDVSRGVRRLGAAAVDMCHVALGIAESYWEYRLKPWDMAAGVLIVEEAGGAVTRM 317

  Fly   245 SGSKFDV 251
            .|.||.|
plant   318 DGGKFSV 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17029NP_001261908.1 IMPase 13..261 CDD:238817 82/256 (32%)
IMPL1NP_564376.1 PLN02737 11..371 CDD:215392 85/267 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0483
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D915621at2759
OrthoFinder 1 1.000 - - FOG0000745
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100401
Panther 1 1.100 - - O PTHR20854
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.870

Return to query results.
Submit another query.