DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17029 and BPNT2

DIOPT Version :9

Sequence 1:NP_001261908.1 Gene:CG17029 / 39740 FlyBaseID:FBgn0036551 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_060283.3 Gene:BPNT2 / 54928 HGNCID:26019 Length:359 Species:Homo sapiens


Alignment Length:257 Identity:58/257 - (22%)
Similarity:95/257 - (36%) Gaps:56/257 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 QEGYQKAKTEYKVKAD---FYDLVTVYDKQIEDILTEGLVAAFPESLIIGEE-------ESAVSQ 83
            :||.:...|...|.::   ||.|.|.:..  ..|.||..|.|..:.:|:.:.       :...:.
Human    99 REGAEDKMTSGDVLSNRKMFYLLKTAFPS--VQINTEEHVDAADQEVILWDHKIPEDILKEVTTP 161

  Fly    84 RQAELTDAPTWIIDPIDGTTNFIHRI-PHCCISVGLAINKELVVGIIYNPPANELFSAY------ 141
            ::........| |||:|.|..:...: .:....|.:|:|.:.::|:|:.|     ||.|      
Human   162 KEVPAESVTVW-IDPLDATQEYTEDLRKYVTTMVCVAVNGKPMLGVIHKP-----FSEYTAWAMV 220

  Fly   142 ------KGHGAYLNGEP------IHTSKVTTIKQAVIAYEISLIHAAGVRDKNVKRLYKMASNAT 194
                  |...:|....|      .|:..|..:.......:.::|.|.|..       ||:.    
Human   221 DGGSNVKARSSYNEKTPRIVVSRSHSGMVKQVALQTFGNQTTIIPAGGAG-------YKVL---- 274

  Fly   195 GTRCFGSAALTLCYVATGQCDAY-HVEDLKPWDIAAGAIILTEAGGTVCHTSGSKFDVMKPD 255
                   |.|.:...:..:.|.| ||..:|.|||.||..||...||.:...||.:......|
Human   275 -------ALLDVPDKSQEKADLYIHVTYIKKWDICAGNAILKALGGHMTTLSGEEISYTGSD 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17029NP_001261908.1 IMPase 13..261 CDD:238817 58/257 (23%)
BPNT2NP_060283.3 IPPase 66..349 CDD:238818 58/257 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 86..106 2/6 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144797
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.