DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17029 and CG7789

DIOPT Version :9

Sequence 1:NP_001261908.1 Gene:CG17029 / 39740 FlyBaseID:FBgn0036551 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_651728.1 Gene:CG7789 / 43516 FlyBaseID:FBgn0039698 Length:306 Species:Drosophila melanogaster


Alignment Length:284 Identity:64/284 - (22%)
Similarity:105/284 - (36%) Gaps:64/284 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSAVSESKLKEYYDVALKLVLKCGPL--MQEGYQKAKTEYKVKADFYDLVTVYDKQIEDILTEG 63
            |:|::|.:|..   ...::.|||.|.|  :.:|....:||             .|:..:..:...
  Fly    12 MASSISTAKRA---GGIIRDVLKKGDLGIVDKGKNDPQTE-------------ADRSAQRCIIAS 60

  Fly    64 LVAAFPESLIIGEEESA---------VSQRQAEL--------------TDAPTWIIDPIDGTTNF 105
            |...||...|||||..:         |::...|.              .|...| :||:|||..:
  Fly    61 LAKKFPTVKIIGEEGGSDLNVCDDWLVNELDEEFLQHSCPAEWKDVKPEDFVIW-VDPLDGTAEY 124

  Fly   106 IH-RIPHCCISVGLAINKELVVGIIYNP----PANELFSAYKGHGAYLNGEPIHTSKVTTIKQAV 165
            .. .:.|..:.:|:|:....|.|||:.|    |..|:.....|    |.|  :.|...|.:....
  Fly   125 TQGHVEHVTVLIGIAVKDAAVGGIIHQPFYQQPDGEMGRTIWG----LKG--LGTGGFTAVPAPA 183

  Fly   166 IAYEISLIHAAGVRDKNVKRLYKMASNA---TGTRCFGSAALTLCYVATGQCDAY--HVEDLKPW 225
            ..:.|:...:      :...|::.|.||   |.....|.|...:..:..|:..||  .....|.|
  Fly   184 GQFIITTTRS------HSNALHQQALNAFASTEVLKVGGAGFKVLQLLEGKAHAYVFATPGCKKW 242

  Fly   226 DIAAGAIILTEAGGTVCHTSGSKF 249
            |..|...:|...||.:.:.:|..:
  Fly   243 DTCAPEAVLEAQGGCLTNINGEHY 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17029NP_001261908.1 IMPase 13..261 CDD:238817 60/272 (22%)
CG7789NP_651728.1 IPPase 12..294 CDD:238818 64/284 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445172
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.