DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17029 and IMPA1

DIOPT Version :9

Sequence 1:NP_001261908.1 Gene:CG17029 / 39740 FlyBaseID:FBgn0036551 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001138350.1 Gene:IMPA1 / 3612 HGNCID:6050 Length:336 Species:Homo sapiens


Alignment Length:266 Identity:94/266 - (35%)
Similarity:152/266 - (57%) Gaps:7/266 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 KEYYDVALKLVLKCGPLMQEGYQKAKTEYKVKADFYDLVTVYDKQIEDILTEGLVAAFPESLIIG 75
            :|..|.|:.|..:.|.::.|.. |.:....:|:...||||..|:::|.:|...:...:|....||
Human    65 QECMDYAVTLARQAGEVVCEAI-KNEMNVMLKSSPVDLVTATDQKVEKMLISSIKEKYPSHSFIG 128

  Fly    76 EEESAVSQRQAELTDAPTWIIDPIDGTTNFIHRIPHCCISVGLAINKELVVGIIYNPPANELFSA 140
            ||..|..::.. |||.||||||||||||||:||.|...:|:|.|:||::..|::|:....::::|
Human   129 EESVAAGEKSI-LTDNPTWIIDPIDGTTNFVHRFPFVAVSIGFAVNKKIEFGVVYSCVEGKMYTA 192

  Fly   141 YKGHGAYLNGEPIHTSKVTTIKQAVIAYEI-SLIHAAGVRD--KNVKRLYKMASNATGTRCFGSA 202
            .||.||:.||:.:..|:...|.::::..|: |......||.  .|:::|:.:..:  |.|..|:|
Human   193 RKGKGAFCNGQKLQVSQQEDITKSLLVTELGSSRTPETVRMVLSNMEKLFCIPVH--GIRSVGTA 255

  Fly   203 ALTLCYVATGQCDAYHVEDLKPWDIAAGAIILTEAGGTVCHTSGSKFDVMKPDCVCAATPELAKN 267
            |:.:|.||||..|||:...:..||:|...||:|||||.:...:|..||:|....:.|....||:.
Human   256 AVNMCLVATGGADAYYEMGIHCWDVAGAGIIVTEAGGVLMDVTGGPFDLMSRRVIAANNRILAER 320

  Fly   268 VISLIE 273
            :...|:
Human   321 IAKEIQ 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17029NP_001261908.1 IMPase 13..261 CDD:238817 90/250 (36%)
IMPA1NP_001138350.1 IMPase 67..313 CDD:238817 89/249 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144793
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0483
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1410
OMA 1 1.010 - - QHG54074
OrthoDB 1 1.010 - - D406919at33208
OrthoFinder 1 1.000 - - FOG0000745
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100401
Panther 1 1.100 - - O PTHR20854
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2586
SonicParanoid 1 1.000 - - X706
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1110.790

Return to query results.
Submit another query.