DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17029 and CG15743

DIOPT Version :9

Sequence 1:NP_001261908.1 Gene:CG17029 / 39740 FlyBaseID:FBgn0036551 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001259511.1 Gene:CG15743 / 32279 FlyBaseID:FBgn0030465 Length:355 Species:Drosophila melanogaster


Alignment Length:270 Identity:68/270 - (25%)
Similarity:100/270 - (37%) Gaps:76/270 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 EYYDVALKLVLKCGPLMQEGYQKAKTEYKVKADFYDLVTVYDKQIEDILTEGLVAAFPESLIIGE 76
            |..|||....||       ...|.||:..|...|.|.    |.:...::.:||...||...|..|
  Fly    74 EVLDVARSRQLK-------ERSKGKTDEGVNDPFTDA----DGRSHCVMKQGLQRIFPRVQIFSE 127

  Fly    77 EES-------------AVSQRQAEL-------TDAPTWIIDPIDGTTNFIHRI-PHCCISVGLAI 120
            |:.             .|....|::       .|...| :||:|.|..|...: .:....|.:|:
  Fly   128 EDKEHCKQAHGYDLDPTVLHETAQIPDVTVNAQDVTVW-VDPLDATKEFTEELYEYVTTMVCVAV 191

  Fly   121 NKELVVGIIYNPPANELFSAYKGH--GAYL----------NGEPI------HTSKVTTIKQAVIA 167
            ....::|:|::|...:...|:.|:  ..||          |..||      ||:....:.:.:..
  Fly   192 AGRPIIGVIHSPFNGQTAWAWVGNSMSEYLSNLHPQHSPNNQAPIITVSRSHTAGAKDLARGIFG 256

  Fly   168 YEISLIHAAGVRDKNVKRLYKMASNATGTRCFGSAALTLCYVATGQCDAY-HVEDLKPWDIAAGA 231
            ..:||:.|||.   ..|.|..:|:|||                     || |...:|.|||.||.
  Fly   257 ENVSLLTAAGA---GYKVLQVVANNAT---------------------AYLHTSKIKKWDICAGD 297

  Fly   232 IILTEAGGTV 241
            .||...|||:
  Fly   298 AILHALGGTM 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17029NP_001261908.1 IMPase 13..261 CDD:238817 67/269 (25%)
CG15743NP_001259511.1 IPPase 59..342 CDD:238818 68/270 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445184
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.