DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17029 and Bpnt2

DIOPT Version :9

Sequence 1:NP_001261908.1 Gene:CG17029 / 39740 FlyBaseID:FBgn0036551 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001008772.2 Gene:Bpnt2 / 312952 RGDID:1306455 Length:356 Species:Rattus norvegicus


Alignment Length:276 Identity:67/276 - (24%)
Similarity:104/276 - (37%) Gaps:73/276 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSAVSESKLKEYYDVALKLVLKCGPLMQEGYQKAKTEYKVKADFYDLVTVYDKQI-EDILTEGL 64
            |:|....|..|.:|     |:....|.:|     ..||..|.|...::: |::::| ||||.|  
  Rat   104 MTSGDVLSNRKMFY-----LLKTAFPNVQ-----INTEEHVDASDKEVI-VWNRKIPEDILKE-- 155

  Fly    65 VAAFPESLIIGEEESAVSQRQAELTDAPTWIIDPIDGTTNFIHRI-PHCCISVGLAINKELVVGI 128
            :||               .::........| |||:|.|..:...: .:....|.:|:|.:.|:|:
  Rat   156 IAA---------------PKEVPAESVTVW-IDPLDATQEYTEDLRKYVTTMVCVAVNGKPVLGV 204

  Fly   129 IYNPPANELFSAY------------KGHGAYLNGEP---IHTSKVTTIKQAVI---AYEISLIHA 175
            |:.|     ||.|            |...:|....|   :..|....:||..:   ..:..:|.|
  Rat   205 IHKP-----FSEYTAWAMVDSGSNVKARSSYNEKTPKIIVSRSHAGMVKQVALQTFGNQTLIIPA 264

  Fly   176 AGVRDKNVKRLYKMASNATGTRCFGSAALTLCYVATGQCDAY-HVEDLKPWDIAAGAIILTEAGG 239
            .|..       ||:.           |.|.:..:...:.|.| ||..:|.|||.||..||...||
  Rat   265 GGAG-------YKVL-----------ALLDVPDMTQEKADLYIHVTYIKKWDICAGNAILKALGG 311

  Fly   240 TVCHTSGSKFDVMKPD 255
            .:...||.:......|
  Rat   312 HMTTLSGEEISYTGSD 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17029NP_001261908.1 IMPase 13..261 CDD:238817 63/264 (24%)
Bpnt2NP_001008772.2 IPPase 64..347 CDD:238818 67/276 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 82..104 67/276 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338491
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.