DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17029 and tol1

DIOPT Version :9

Sequence 1:NP_001261908.1 Gene:CG17029 / 39740 FlyBaseID:FBgn0036551 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_588230.1 Gene:tol1 / 2538954 PomBaseID:SPCC1753.04 Length:353 Species:Schizosaccharomyces pombe


Alignment Length:277 Identity:67/277 - (24%)
Similarity:96/277 - (34%) Gaps:87/277 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 VTVYDKQIEDILTEGLVAAFPESLIIGEEES-------AVSQRQAELT----------------- 89
            ||:.|...:.|:...|..|||...|:|||:|       ....|..||.                 
pombe    46 VTIGDFGAQAIVISMLKDAFPNDPIVGEEDSDFLRENTQTCSRVWELVQETIQHATEYKELGQIK 110

  Fly    90 ------------------DAPTWIIDPIDGTTNFIHRIPHCCISVGLAINKELVVGII------- 129
                              :...|.:||||||..|: |.....|.:.|..|.:.||..|       
pombe   111 SAEEMMSIIDQGSYHGGRNGRMWTLDPIDGTKGFL-RGAQYAICLALIENGKPVVSAIGCPNLPY 174

  Fly   130 -YNPPANE----LFSAYKGHGAY---LNGE-----PIHTSKVTTIKQAVIAYEISLIHA-AGVRD 180
             :|.|...    :.||.:.||.:   |:.|     .:|...|...|.:.....:...|: .|.::
pombe   175 DFNQPETSPKGIIMSAVRNHGCFQYSLHNEKLEPVQVHMQDVQNTKDSKFCEGVEAGHSMQGTQE 239

  Fly   181 KNVKRL------YKMASNATGTRCFGSAALTLCYVATGQCDAY------HVEDLKPWDIAAGAII 233
            :..|.|      .||.|.|.    :.|       :|.|..|.|      ...:.|.||.|.|:::
pombe   240 EIAKYLGITRGPTKMDSQAK----YAS-------LARGDGDIYLRLPTKMTFEEKIWDHAGGSLL 293

  Fly   234 LTEAGGTVCHTSGSKFD 250
            :.||||.|....|...|
pombe   294 VEEAGGVVSDMFGKPLD 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17029NP_001261908.1 IMPase 13..261 CDD:238817 67/277 (24%)
tol1NP_588230.1 bisphos_HAL2 2..352 CDD:273558 67/277 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 47 1.000 Domainoid score I3498
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 47 1.000 Inparanoid score I2070
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.